Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9P977

Protein Details
Accession G9P977    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKNKKAHNIKFKVRCQKHHydrophilic
NLS Segment(s)
PositionSequence
22-33SARIKKNKKAHN
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKEVADIKKFIEICRRKDASSARIKKNKKAHNIKFKVRCQKHLYTLVLKDNDKAEKLKQSLPPNLQIAEVSKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.5
4 0.45
5 0.51
6 0.54
7 0.53
8 0.57
9 0.6
10 0.6
11 0.66
12 0.69
13 0.71
14 0.75
15 0.74
16 0.73
17 0.75
18 0.75
19 0.78
20 0.82
21 0.82
22 0.82
23 0.81
24 0.82
25 0.73
26 0.71
27 0.66
28 0.64
29 0.61
30 0.59
31 0.55
32 0.49
33 0.5
34 0.48
35 0.45
36 0.41
37 0.36
38 0.32
39 0.31
40 0.28
41 0.27
42 0.25
43 0.29
44 0.32
45 0.36
46 0.4
47 0.46
48 0.52
49 0.54
50 0.57
51 0.52
52 0.49
53 0.44
54 0.37
55 0.34