Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IHK0

Protein Details
Accession A0A1Y2IHK0   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-30ARASLRSSSKRHPNPRLVQLQPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036010  2Fe-2S_ferredoxin-like_sf  
IPR001041  2Fe-2S_ferredoxin-type  
IPR001055  Adrenodoxin  
IPR018298  Adrenodoxin_Fe-S_BS  
IPR012675  Beta-grasp_dom_sf  
Gene Ontology GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0140647  P:P450-containing electron transport chain  
Pfam View protein in Pfam  
PF00111  Fer2  
PROSITE View protein in PROSITE  
PS51085  2FE2S_FER_2  
PS00814  ADX  
CDD cd00207  fer2  
Amino Acid Sequences MASLAQTFARASLRSSSKRHPNPRLVQLQPSSSYRPLAPSHARRCSSLASSHALTRSSPVRCPKPAVHRPLAARAFHTTNVARHGGIDRPEPGTGLKVHFKDHKGNLIKTVEANEGDDILSIAHEYDIDLEGACEGSVACSTCHVIVDPDHYDLLPEPEDDENDMLDMAFGLTDTSRLGCQVRLTKELDGITCTLPSATRNMFVDGKKPTHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.49
4 0.57
5 0.67
6 0.75
7 0.77
8 0.79
9 0.81
10 0.85
11 0.85
12 0.77
13 0.75
14 0.68
15 0.62
16 0.56
17 0.51
18 0.46
19 0.39
20 0.38
21 0.3
22 0.31
23 0.29
24 0.32
25 0.38
26 0.43
27 0.5
28 0.57
29 0.58
30 0.55
31 0.56
32 0.52
33 0.46
34 0.4
35 0.34
36 0.29
37 0.29
38 0.3
39 0.29
40 0.25
41 0.22
42 0.21
43 0.25
44 0.22
45 0.27
46 0.32
47 0.37
48 0.39
49 0.44
50 0.48
51 0.53
52 0.59
53 0.61
54 0.58
55 0.57
56 0.57
57 0.6
58 0.57
59 0.47
60 0.41
61 0.37
62 0.33
63 0.29
64 0.3
65 0.23
66 0.2
67 0.23
68 0.22
69 0.18
70 0.17
71 0.18
72 0.17
73 0.17
74 0.17
75 0.15
76 0.16
77 0.16
78 0.16
79 0.14
80 0.13
81 0.12
82 0.13
83 0.17
84 0.16
85 0.18
86 0.23
87 0.25
88 0.29
89 0.3
90 0.36
91 0.36
92 0.35
93 0.37
94 0.34
95 0.32
96 0.26
97 0.26
98 0.19
99 0.14
100 0.15
101 0.1
102 0.09
103 0.09
104 0.08
105 0.06
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.05
116 0.05
117 0.04
118 0.05
119 0.05
120 0.04
121 0.04
122 0.03
123 0.03
124 0.04
125 0.05
126 0.05
127 0.06
128 0.07
129 0.07
130 0.08
131 0.07
132 0.08
133 0.08
134 0.12
135 0.13
136 0.14
137 0.14
138 0.13
139 0.14
140 0.13
141 0.15
142 0.11
143 0.1
144 0.11
145 0.11
146 0.12
147 0.13
148 0.12
149 0.1
150 0.09
151 0.09
152 0.07
153 0.06
154 0.05
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.05
162 0.06
163 0.06
164 0.08
165 0.09
166 0.11
167 0.17
168 0.24
169 0.27
170 0.31
171 0.33
172 0.33
173 0.36
174 0.36
175 0.31
176 0.26
177 0.24
178 0.21
179 0.18
180 0.17
181 0.14
182 0.13
183 0.13
184 0.16
185 0.16
186 0.2
187 0.21
188 0.26
189 0.31
190 0.31
191 0.36
192 0.38