Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2J163

Protein Details
Accession A0A1Y2J163   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
474-494TTRARSQEVKRLVKKCRDAGWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, cyto_mito 12.333, cyto_nucl 10.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005835  NTP_transferase_dom  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016779  F:nucleotidyltransferase activity  
GO:0044271  P:cellular nitrogen compound biosynthetic process  
Pfam View protein in Pfam  
PF00483  NTP_transferase  
CDD cd02509  GDP-M1P_Guanylyltransferase  
Amino Acid Sequences MSVPATQAASANPAAQAAGGLPIEFMFKQIMEAVHKSQMEIAELRSECHELRQANASLERQVREGIQSNNGTSRLGTPGFNTPAPGSPQLRAKSPFLTPNTVPTLAVPPSIYVPSPLSDHSLTQFNFGVREIPGFWVVIPAGGAGTRLWPLSREEHPKFLLDLTLKGRSLIQATWDRLIPLSSPARTAVVAGPAHVKSIKEQLPDLLPHNLFCEPSAKESMAAIGLAAAVLALRDPNAIIGSFAADHMISGDDAFLAAVAEAVEVAKKDYLVTIGIAPSHPSTGFGYVRLGEKLGFQDAPNARLVSSFKEKPDARTAAAYIKTGNYRWNAGMFVTKATFLMELLKEYKPELHEGLQKVARAWDDESLRQKVLDEVWPNLEKIAIDNAVAEPAALDRRVAVVPATFGWDDVGDFSSLADLLPAESNQPRILGDSGLVVTEQAAGGIVVPGSGRLVSLLGVDDLVIVDMPDTLLVTTRARSQEVKRLVKKCRDAGWKQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.07
5 0.09
6 0.08
7 0.08
8 0.08
9 0.08
10 0.11
11 0.11
12 0.11
13 0.1
14 0.09
15 0.11
16 0.13
17 0.16
18 0.18
19 0.22
20 0.25
21 0.3
22 0.3
23 0.29
24 0.29
25 0.28
26 0.26
27 0.24
28 0.22
29 0.23
30 0.24
31 0.24
32 0.24
33 0.26
34 0.22
35 0.25
36 0.3
37 0.23
38 0.25
39 0.31
40 0.32
41 0.33
42 0.37
43 0.34
44 0.35
45 0.39
46 0.37
47 0.31
48 0.3
49 0.27
50 0.27
51 0.31
52 0.27
53 0.3
54 0.31
55 0.32
56 0.34
57 0.34
58 0.29
59 0.24
60 0.24
61 0.21
62 0.2
63 0.19
64 0.18
65 0.24
66 0.28
67 0.27
68 0.27
69 0.24
70 0.26
71 0.3
72 0.33
73 0.28
74 0.28
75 0.35
76 0.36
77 0.4
78 0.4
79 0.38
80 0.36
81 0.38
82 0.42
83 0.39
84 0.43
85 0.38
86 0.4
87 0.43
88 0.4
89 0.35
90 0.29
91 0.3
92 0.24
93 0.24
94 0.18
95 0.14
96 0.15
97 0.16
98 0.15
99 0.12
100 0.13
101 0.13
102 0.14
103 0.15
104 0.17
105 0.17
106 0.18
107 0.18
108 0.23
109 0.22
110 0.23
111 0.24
112 0.2
113 0.2
114 0.19
115 0.19
116 0.13
117 0.14
118 0.12
119 0.12
120 0.12
121 0.12
122 0.11
123 0.11
124 0.1
125 0.09
126 0.08
127 0.06
128 0.05
129 0.05
130 0.06
131 0.04
132 0.05
133 0.06
134 0.06
135 0.07
136 0.08
137 0.11
138 0.15
139 0.22
140 0.3
141 0.32
142 0.37
143 0.38
144 0.37
145 0.35
146 0.31
147 0.29
148 0.2
149 0.21
150 0.2
151 0.23
152 0.22
153 0.21
154 0.21
155 0.18
156 0.19
157 0.16
158 0.18
159 0.2
160 0.22
161 0.23
162 0.23
163 0.22
164 0.2
165 0.2
166 0.15
167 0.14
168 0.16
169 0.15
170 0.16
171 0.16
172 0.17
173 0.16
174 0.17
175 0.13
176 0.14
177 0.14
178 0.13
179 0.16
180 0.15
181 0.16
182 0.16
183 0.15
184 0.11
185 0.19
186 0.22
187 0.2
188 0.2
189 0.21
190 0.22
191 0.24
192 0.24
193 0.22
194 0.19
195 0.18
196 0.2
197 0.19
198 0.16
199 0.15
200 0.16
201 0.12
202 0.14
203 0.16
204 0.14
205 0.14
206 0.14
207 0.14
208 0.1
209 0.09
210 0.06
211 0.04
212 0.04
213 0.03
214 0.03
215 0.02
216 0.02
217 0.02
218 0.02
219 0.02
220 0.02
221 0.02
222 0.02
223 0.03
224 0.03
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.02
244 0.02
245 0.02
246 0.02
247 0.02
248 0.02
249 0.02
250 0.03
251 0.03
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.05
258 0.05
259 0.06
260 0.06
261 0.06
262 0.07
263 0.07
264 0.08
265 0.07
266 0.08
267 0.07
268 0.08
269 0.08
270 0.12
271 0.12
272 0.12
273 0.12
274 0.13
275 0.14
276 0.13
277 0.13
278 0.09
279 0.1
280 0.1
281 0.11
282 0.11
283 0.09
284 0.17
285 0.18
286 0.19
287 0.2
288 0.19
289 0.17
290 0.18
291 0.19
292 0.16
293 0.22
294 0.23
295 0.22
296 0.3
297 0.31
298 0.34
299 0.41
300 0.38
301 0.33
302 0.32
303 0.32
304 0.3
305 0.3
306 0.26
307 0.19
308 0.19
309 0.2
310 0.19
311 0.22
312 0.18
313 0.19
314 0.19
315 0.2
316 0.18
317 0.16
318 0.19
319 0.15
320 0.15
321 0.13
322 0.13
323 0.12
324 0.12
325 0.11
326 0.08
327 0.11
328 0.1
329 0.11
330 0.14
331 0.15
332 0.15
333 0.16
334 0.18
335 0.16
336 0.19
337 0.19
338 0.2
339 0.26
340 0.27
341 0.32
342 0.31
343 0.3
344 0.28
345 0.28
346 0.24
347 0.2
348 0.2
349 0.19
350 0.2
351 0.24
352 0.3
353 0.3
354 0.3
355 0.28
356 0.27
357 0.24
358 0.24
359 0.25
360 0.22
361 0.21
362 0.26
363 0.27
364 0.27
365 0.25
366 0.23
367 0.16
368 0.15
369 0.17
370 0.12
371 0.11
372 0.11
373 0.12
374 0.11
375 0.11
376 0.09
377 0.05
378 0.06
379 0.09
380 0.08
381 0.07
382 0.07
383 0.1
384 0.1
385 0.11
386 0.1
387 0.09
388 0.1
389 0.1
390 0.14
391 0.11
392 0.11
393 0.12
394 0.11
395 0.11
396 0.11
397 0.12
398 0.08
399 0.08
400 0.08
401 0.07
402 0.07
403 0.07
404 0.06
405 0.04
406 0.05
407 0.07
408 0.07
409 0.1
410 0.12
411 0.14
412 0.15
413 0.15
414 0.14
415 0.16
416 0.17
417 0.14
418 0.13
419 0.13
420 0.12
421 0.12
422 0.11
423 0.08
424 0.08
425 0.08
426 0.07
427 0.05
428 0.05
429 0.04
430 0.05
431 0.05
432 0.05
433 0.04
434 0.04
435 0.05
436 0.05
437 0.06
438 0.05
439 0.05
440 0.06
441 0.06
442 0.07
443 0.07
444 0.07
445 0.07
446 0.07
447 0.06
448 0.06
449 0.06
450 0.05
451 0.04
452 0.04
453 0.04
454 0.04
455 0.04
456 0.05
457 0.04
458 0.06
459 0.09
460 0.1
461 0.12
462 0.18
463 0.21
464 0.24
465 0.31
466 0.35
467 0.43
468 0.52
469 0.61
470 0.64
471 0.69
472 0.76
473 0.8
474 0.83
475 0.8
476 0.79
477 0.79
478 0.76