Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ILT2

Protein Details
Accession A0A1Y2ILT2   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
95-125RTDPIKTSPRRSHRPHKKQCHHPRRVHARAPBasic
NLS Segment(s)
PositionSequence
102-121SPRRSHRPHKKQCHHPRRVH
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MLKKRQDTASLGQRQPPTIQPLPEHGHRPRRSHAAMGLCMTVTLISKQAPCFLHPATITRLAPRRLRSLTSASGPEHNKNTLRLERPATLPRVQRTDPIKTSPRRSHRPHKKQCHHPRRVHARAPPPPALAYLPAASQHRYICVRVSRTKQHNRNASRPSSPLTRSPPDSDAPSDAGLLFSRGAARPTTRRDDSVTLRRRAVRSARLQPAANAAASRLTTPRRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.51
3 0.47
4 0.45
5 0.41
6 0.42
7 0.37
8 0.42
9 0.45
10 0.47
11 0.5
12 0.5
13 0.55
14 0.58
15 0.62
16 0.61
17 0.64
18 0.62
19 0.59
20 0.56
21 0.53
22 0.49
23 0.45
24 0.39
25 0.3
26 0.27
27 0.22
28 0.16
29 0.1
30 0.08
31 0.08
32 0.1
33 0.12
34 0.13
35 0.19
36 0.19
37 0.2
38 0.23
39 0.22
40 0.25
41 0.23
42 0.25
43 0.24
44 0.29
45 0.28
46 0.3
47 0.35
48 0.36
49 0.41
50 0.41
51 0.44
52 0.4
53 0.42
54 0.41
55 0.4
56 0.38
57 0.36
58 0.35
59 0.3
60 0.33
61 0.34
62 0.33
63 0.31
64 0.31
65 0.29
66 0.29
67 0.34
68 0.34
69 0.34
70 0.35
71 0.36
72 0.35
73 0.37
74 0.39
75 0.37
76 0.36
77 0.37
78 0.36
79 0.38
80 0.36
81 0.38
82 0.38
83 0.41
84 0.38
85 0.39
86 0.44
87 0.43
88 0.51
89 0.54
90 0.58
91 0.6
92 0.65
93 0.7
94 0.74
95 0.8
96 0.83
97 0.85
98 0.87
99 0.89
100 0.93
101 0.93
102 0.91
103 0.87
104 0.86
105 0.86
106 0.84
107 0.78
108 0.74
109 0.72
110 0.69
111 0.67
112 0.6
113 0.5
114 0.43
115 0.38
116 0.32
117 0.24
118 0.18
119 0.12
120 0.1
121 0.11
122 0.12
123 0.12
124 0.14
125 0.13
126 0.15
127 0.16
128 0.17
129 0.19
130 0.23
131 0.28
132 0.32
133 0.38
134 0.44
135 0.52
136 0.62
137 0.66
138 0.7
139 0.74
140 0.74
141 0.77
142 0.75
143 0.7
144 0.63
145 0.57
146 0.52
147 0.48
148 0.44
149 0.42
150 0.42
151 0.42
152 0.43
153 0.44
154 0.43
155 0.4
156 0.4
157 0.36
158 0.31
159 0.28
160 0.24
161 0.21
162 0.17
163 0.16
164 0.13
165 0.11
166 0.09
167 0.08
168 0.09
169 0.1
170 0.11
171 0.13
172 0.17
173 0.23
174 0.3
175 0.37
176 0.38
177 0.4
178 0.44
179 0.48
180 0.52
181 0.56
182 0.59
183 0.55
184 0.58
185 0.61
186 0.58
187 0.59
188 0.59
189 0.58
190 0.59
191 0.64
192 0.67
193 0.66
194 0.65
195 0.58
196 0.57
197 0.49
198 0.41
199 0.31
200 0.23
201 0.2
202 0.2
203 0.21
204 0.19
205 0.23