Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IPZ5

Protein Details
Accession A0A1Y2IPZ5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-40SGAKGQKERKQKKGPPSPIVHydrophilic
NLS Segment(s)
PositionSequence
26-34QKERKQKKG
Subcellular Location(s) cyto 16.5, cyto_nucl 12, mito 5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MGCIPSKQKVLDGDSSTTAISGAKGQKERKQKKGPPSPIVADDAPPWVKGAASRVLTHKDGTIIITETQSVQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.29
4 0.24
5 0.2
6 0.13
7 0.1
8 0.12
9 0.14
10 0.17
11 0.23
12 0.28
13 0.34
14 0.45
15 0.53
16 0.58
17 0.66
18 0.68
19 0.73
20 0.8
21 0.81
22 0.75
23 0.71
24 0.63
25 0.54
26 0.5
27 0.39
28 0.3
29 0.22
30 0.2
31 0.17
32 0.14
33 0.13
34 0.1
35 0.1
36 0.1
37 0.13
38 0.15
39 0.17
40 0.19
41 0.22
42 0.27
43 0.28
44 0.28
45 0.26
46 0.21
47 0.2
48 0.19
49 0.17
50 0.15
51 0.15
52 0.14
53 0.14