Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2I669

Protein Details
Accession A0A1Y2I669   
Localization Confidence High
Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
103-124VDSDKFTKSKKAETRPRSRRDKBasic
NLS Segment(s)
PositionSequence
49-58PSGKRKAPRK
86-95SSKGSKKPRS
107-124KFTKSKKAETRPRSRRDK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MPIDEAISDSTKRDFRESSPLSDVPSSGVEESEDNAPPSKKPRTDNTSPSGKRKAPRKAVDQAGTLGIRTAGRHAGLSSLPPGGGSSKGSKKPRSSAASASGVDSDKFTKSKKAETRPRSRRDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.37
4 0.39
5 0.4
6 0.43
7 0.41
8 0.39
9 0.38
10 0.34
11 0.25
12 0.24
13 0.19
14 0.13
15 0.13
16 0.11
17 0.1
18 0.12
19 0.12
20 0.12
21 0.11
22 0.14
23 0.14
24 0.15
25 0.21
26 0.27
27 0.3
28 0.33
29 0.42
30 0.47
31 0.54
32 0.59
33 0.58
34 0.61
35 0.59
36 0.61
37 0.59
38 0.55
39 0.53
40 0.55
41 0.59
42 0.58
43 0.61
44 0.62
45 0.62
46 0.64
47 0.61
48 0.53
49 0.44
50 0.36
51 0.3
52 0.23
53 0.16
54 0.1
55 0.08
56 0.07
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.08
64 0.09
65 0.09
66 0.08
67 0.08
68 0.07
69 0.08
70 0.07
71 0.08
72 0.1
73 0.15
74 0.21
75 0.3
76 0.37
77 0.43
78 0.47
79 0.52
80 0.59
81 0.59
82 0.56
83 0.53
84 0.53
85 0.51
86 0.47
87 0.42
88 0.35
89 0.3
90 0.26
91 0.22
92 0.18
93 0.16
94 0.18
95 0.19
96 0.25
97 0.28
98 0.38
99 0.46
100 0.55
101 0.63
102 0.71
103 0.81
104 0.83