Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IMW7

Protein Details
Accession A0A1Y2IMW7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-91GLAFARRRDGRQRRRKPLWEGRHGSABasic
NLS Segment(s)
PositionSequence
54-99RRRRATKTKKADGLAFARRRDGRQRRRKPLWEGRHGSAARGGRPVL
Subcellular Location(s) extr 18, plas 5, mito 2
Family & Domain DBs
Amino Acid Sequences MTELAGTDCGREGTDLANLRAMAVLGVAAVTRALVLVRATANKVAVGCVCVWLRRRRATKTKKADGLAFARRRDGRQRRRKPLWEGRHGSAARGGRPVLRGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.19
5 0.19
6 0.18
7 0.18
8 0.16
9 0.1
10 0.07
11 0.06
12 0.03
13 0.03
14 0.03
15 0.03
16 0.02
17 0.02
18 0.02
19 0.02
20 0.03
21 0.03
22 0.04
23 0.05
24 0.06
25 0.07
26 0.08
27 0.09
28 0.1
29 0.09
30 0.09
31 0.09
32 0.08
33 0.08
34 0.07
35 0.09
36 0.09
37 0.11
38 0.15
39 0.21
40 0.26
41 0.33
42 0.38
43 0.43
44 0.54
45 0.62
46 0.68
47 0.72
48 0.75
49 0.73
50 0.7
51 0.65
52 0.59
53 0.55
54 0.54
55 0.49
56 0.42
57 0.42
58 0.42
59 0.44
60 0.49
61 0.54
62 0.56
63 0.62
64 0.72
65 0.77
66 0.85
67 0.89
68 0.89
69 0.89
70 0.88
71 0.88
72 0.83
73 0.76
74 0.76
75 0.67
76 0.58
77 0.53
78 0.47
79 0.38
80 0.35
81 0.32
82 0.26