Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NT18

Protein Details
Accession G9NT18    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-72VIGEISEKRKKRKKEKKRIKSHRLVHFBasic
NLS Segment(s)
PositionSequence
53-68KRKKRKKEKKRIKSHR
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MGPRHPQCNQSFTTPRVAFGGTAGGAMSARWPIERTKTPHACRWLVIGEISEKRKKRKKEKKRIKSHRLVHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.37
4 0.35
5 0.26
6 0.21
7 0.2
8 0.1
9 0.1
10 0.08
11 0.07
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.06
19 0.08
20 0.14
21 0.2
22 0.24
23 0.33
24 0.42
25 0.45
26 0.5
27 0.54
28 0.49
29 0.44
30 0.42
31 0.33
32 0.25
33 0.22
34 0.17
35 0.16
36 0.2
37 0.25
38 0.29
39 0.32
40 0.42
41 0.5
42 0.59
43 0.67
44 0.73
45 0.8
46 0.84
47 0.92
48 0.93
49 0.96
50 0.97
51 0.97
52 0.96