Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2INL9

Protein Details
Accession A0A1Y2INL9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNRKAHRNGIKKPKTHydrophilic
NLS Segment(s)
PositionSequence
14-55RKAHRNGIKKPKTHRTRSMKGVDPKFRRNSKYALVGSRKARA
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKKPKTHRTRSMKGVDPKFRRNSKYALVGSRKARAEQKAAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.78
5 0.77
6 0.78
7 0.81
8 0.79
9 0.77
10 0.78
11 0.79
12 0.79
13 0.77
14 0.78
15 0.76
16 0.74
17 0.76
18 0.74
19 0.71
20 0.7
21 0.7
22 0.69
23 0.65
24 0.67
25 0.67
26 0.68
27 0.64
28 0.59
29 0.56
30 0.52
31 0.55
32 0.51
33 0.51
34 0.5
35 0.53
36 0.53
37 0.55
38 0.52
39 0.47
40 0.5
41 0.46
42 0.46
43 0.44