Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2J4S9

Protein Details
Accession A0A1Y2J4S9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-71TEWCTTRPPSRARRRRSHASSLPHydrophilic
NLS Segment(s)
PositionSequence
61-62RR
Subcellular Location(s) mito 10, nucl 6, cyto_mito 6, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MESSRAPRSPTPAVRIASHCYPYAFTSSSPLGFPARPRPSPDFLTSRGTEWCTTRPPSRARRRRSHASSLPLPHLHLRLSPFASPSPYMLSPQCLPLATRFSRTLVRIACLRWTLSRAERANELNERTMSRTDRTHCLSPHPIRIPSPSASYPICLLASTHPISFVAVRFALRCSSRSHPSAARVLHTLSIIIIHHHRHRRTSLICTIQPHASSIPAPARICLFALALFAYLFIILVRHASSEGRRVGRKLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.52
4 0.49
5 0.45
6 0.4
7 0.34
8 0.33
9 0.3
10 0.31
11 0.26
12 0.2
13 0.22
14 0.23
15 0.23
16 0.22
17 0.22
18 0.2
19 0.21
20 0.25
21 0.3
22 0.36
23 0.38
24 0.44
25 0.48
26 0.51
27 0.54
28 0.55
29 0.5
30 0.46
31 0.5
32 0.44
33 0.4
34 0.37
35 0.35
36 0.31
37 0.29
38 0.29
39 0.28
40 0.32
41 0.36
42 0.4
43 0.46
44 0.54
45 0.63
46 0.68
47 0.72
48 0.78
49 0.81
50 0.85
51 0.84
52 0.84
53 0.79
54 0.77
55 0.75
56 0.69
57 0.65
58 0.55
59 0.49
60 0.42
61 0.36
62 0.29
63 0.24
64 0.23
65 0.21
66 0.22
67 0.22
68 0.2
69 0.2
70 0.22
71 0.2
72 0.18
73 0.18
74 0.16
75 0.17
76 0.16
77 0.18
78 0.17
79 0.18
80 0.18
81 0.14
82 0.14
83 0.15
84 0.21
85 0.19
86 0.21
87 0.21
88 0.22
89 0.25
90 0.25
91 0.28
92 0.22
93 0.23
94 0.21
95 0.21
96 0.21
97 0.19
98 0.19
99 0.15
100 0.16
101 0.17
102 0.17
103 0.25
104 0.23
105 0.23
106 0.25
107 0.26
108 0.27
109 0.27
110 0.26
111 0.2
112 0.2
113 0.19
114 0.18
115 0.2
116 0.18
117 0.17
118 0.2
119 0.21
120 0.25
121 0.29
122 0.31
123 0.29
124 0.32
125 0.39
126 0.38
127 0.43
128 0.42
129 0.39
130 0.36
131 0.38
132 0.36
133 0.29
134 0.3
135 0.23
136 0.22
137 0.21
138 0.21
139 0.18
140 0.16
141 0.14
142 0.1
143 0.1
144 0.09
145 0.14
146 0.14
147 0.14
148 0.13
149 0.13
150 0.13
151 0.14
152 0.12
153 0.1
154 0.09
155 0.1
156 0.1
157 0.11
158 0.14
159 0.14
160 0.15
161 0.18
162 0.23
163 0.28
164 0.29
165 0.33
166 0.33
167 0.36
168 0.41
169 0.37
170 0.34
171 0.3
172 0.29
173 0.26
174 0.22
175 0.18
176 0.12
177 0.12
178 0.1
179 0.1
180 0.12
181 0.16
182 0.23
183 0.32
184 0.34
185 0.38
186 0.41
187 0.47
188 0.48
189 0.51
190 0.52
191 0.51
192 0.52
193 0.5
194 0.51
195 0.46
196 0.42
197 0.37
198 0.29
199 0.23
200 0.21
201 0.21
202 0.22
203 0.24
204 0.24
205 0.23
206 0.24
207 0.24
208 0.24
209 0.2
210 0.17
211 0.11
212 0.12
213 0.11
214 0.1
215 0.08
216 0.08
217 0.07
218 0.06
219 0.06
220 0.05
221 0.05
222 0.04
223 0.06
224 0.06
225 0.07
226 0.08
227 0.12
228 0.15
229 0.22
230 0.29
231 0.34
232 0.38
233 0.39