Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2ITL6

Protein Details
Accession A0A1Y2ITL6    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MLQRRKNLSHKQRREQMMLKRAVKHydrophilic
26-55GDVPAPPPSKPDRRTRKPRNTKHSLHTAPLHydrophilic
117-138PDLTCPRRPKWRYDMSKNEVEAHydrophilic
632-660RAGSAGPSGRRGRRPRRWSRTSPWTARVSHydrophilic
NLS Segment(s)
PositionSequence
8-47LSHKQRREQMMLKRAVKRGDVPAPPPSKPDRRTRKPRNTK
631-651PRAGSAGPSGRRGRRPRRWSR
Subcellular Location(s) mito 18, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043358  GNL1-like  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
Amino Acid Sequences MLQRRKNLSHKQRREQMMLKRAVKRGDVPAPPPSKPDRRTRKPRNTKHSLHTAPLAASSRRLESSFVRLPKSFLKKTDVLASRLPLARPVPPHAAVFPEVARSPPRMDGEGGEEGSPDLTCPRRPKWRYDMSKNEVEANEQGLFRKWLEQTDAAVNAWCSVEDTAEQDQKAQSQPQPQEPEGPKEPEEMPHAPTSFERNLEVWRQVWRVTEISEILLILLDSRCPTLHLPPALTAYLSSVSNASRLRLILVLTKVDIAGPARAAAWTAYLHARHPGLRVVQVESYAEKTHPDANSAHRRVLEPHLASPFRRALVDALRETHAELLSPPESVRGDPGKMARWRPRVRREVDWEAVLNAQGSKVGAAVGPHGHARKPSKGAPEGGAEGEQAEQEDAQRTDDEIEPEMLTIGVIGQPNVGKSSLLNALFGAHKVKASRTPGKTKHFQTLFWTPEVRLVDCPGLVFPNYVPMETQVLSAILPISRVSAISLCIYHAAQLLPLEQILGLEHPALAEPSVEYKRTWREGMRPAHAAAAAAAAEGDAATQQQPRRAKEPVWTAMDIMTAYALKKGWVTARVGGPDVKRAGNASTSLSSLSLPHTDAHAKQCFFQLFDSCIRHHLTHPALPVQSSARSPRAGSAGPSGRRGRRPRRWSRTSPWTARVSGSVRRTRARTCTTTSTTPAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.83
4 0.82
5 0.81
6 0.79
7 0.77
8 0.75
9 0.71
10 0.66
11 0.61
12 0.6
13 0.59
14 0.56
15 0.52
16 0.56
17 0.57
18 0.54
19 0.54
20 0.54
21 0.56
22 0.56
23 0.63
24 0.65
25 0.71
26 0.81
27 0.87
28 0.9
29 0.91
30 0.95
31 0.95
32 0.94
33 0.91
34 0.88
35 0.88
36 0.81
37 0.74
38 0.68
39 0.6
40 0.5
41 0.47
42 0.42
43 0.32
44 0.31
45 0.29
46 0.28
47 0.27
48 0.28
49 0.26
50 0.25
51 0.33
52 0.37
53 0.39
54 0.41
55 0.39
56 0.42
57 0.48
58 0.54
59 0.51
60 0.47
61 0.5
62 0.48
63 0.51
64 0.57
65 0.53
66 0.47
67 0.45
68 0.43
69 0.42
70 0.42
71 0.39
72 0.34
73 0.31
74 0.32
75 0.32
76 0.36
77 0.36
78 0.35
79 0.36
80 0.32
81 0.34
82 0.3
83 0.28
84 0.23
85 0.21
86 0.19
87 0.2
88 0.21
89 0.2
90 0.21
91 0.25
92 0.27
93 0.25
94 0.26
95 0.25
96 0.28
97 0.29
98 0.28
99 0.22
100 0.19
101 0.17
102 0.17
103 0.15
104 0.1
105 0.1
106 0.12
107 0.18
108 0.24
109 0.31
110 0.42
111 0.46
112 0.54
113 0.61
114 0.69
115 0.73
116 0.77
117 0.81
118 0.77
119 0.8
120 0.73
121 0.68
122 0.57
123 0.5
124 0.41
125 0.33
126 0.29
127 0.22
128 0.21
129 0.18
130 0.19
131 0.17
132 0.21
133 0.19
134 0.2
135 0.24
136 0.24
137 0.25
138 0.27
139 0.28
140 0.23
141 0.22
142 0.2
143 0.16
144 0.14
145 0.11
146 0.09
147 0.08
148 0.08
149 0.08
150 0.11
151 0.15
152 0.18
153 0.18
154 0.19
155 0.19
156 0.22
157 0.24
158 0.25
159 0.24
160 0.3
161 0.34
162 0.4
163 0.46
164 0.44
165 0.5
166 0.49
167 0.52
168 0.48
169 0.47
170 0.4
171 0.37
172 0.37
173 0.31
174 0.34
175 0.29
176 0.27
177 0.27
178 0.27
179 0.24
180 0.24
181 0.28
182 0.24
183 0.24
184 0.22
185 0.19
186 0.22
187 0.25
188 0.26
189 0.21
190 0.23
191 0.24
192 0.23
193 0.24
194 0.24
195 0.21
196 0.2
197 0.21
198 0.17
199 0.15
200 0.14
201 0.12
202 0.09
203 0.08
204 0.06
205 0.06
206 0.05
207 0.05
208 0.05
209 0.06
210 0.06
211 0.08
212 0.1
213 0.13
214 0.18
215 0.2
216 0.2
217 0.21
218 0.23
219 0.21
220 0.2
221 0.16
222 0.11
223 0.11
224 0.1
225 0.09
226 0.08
227 0.08
228 0.12
229 0.12
230 0.11
231 0.11
232 0.11
233 0.12
234 0.12
235 0.12
236 0.13
237 0.14
238 0.14
239 0.13
240 0.13
241 0.12
242 0.11
243 0.11
244 0.07
245 0.07
246 0.06
247 0.06
248 0.06
249 0.06
250 0.07
251 0.06
252 0.06
253 0.06
254 0.07
255 0.09
256 0.1
257 0.1
258 0.13
259 0.14
260 0.14
261 0.15
262 0.16
263 0.15
264 0.18
265 0.19
266 0.18
267 0.17
268 0.17
269 0.16
270 0.14
271 0.15
272 0.12
273 0.11
274 0.1
275 0.11
276 0.15
277 0.14
278 0.16
279 0.16
280 0.23
281 0.33
282 0.34
283 0.35
284 0.31
285 0.32
286 0.33
287 0.36
288 0.34
289 0.25
290 0.25
291 0.29
292 0.29
293 0.28
294 0.28
295 0.25
296 0.19
297 0.18
298 0.17
299 0.14
300 0.17
301 0.21
302 0.18
303 0.18
304 0.19
305 0.19
306 0.18
307 0.17
308 0.13
309 0.09
310 0.08
311 0.1
312 0.09
313 0.09
314 0.09
315 0.09
316 0.1
317 0.1
318 0.13
319 0.11
320 0.11
321 0.13
322 0.15
323 0.19
324 0.23
325 0.28
326 0.33
327 0.41
328 0.49
329 0.56
330 0.63
331 0.66
332 0.66
333 0.67
334 0.67
335 0.65
336 0.59
337 0.51
338 0.42
339 0.34
340 0.3
341 0.23
342 0.15
343 0.08
344 0.06
345 0.05
346 0.05
347 0.04
348 0.04
349 0.04
350 0.04
351 0.04
352 0.05
353 0.06
354 0.06
355 0.08
356 0.09
357 0.1
358 0.14
359 0.18
360 0.21
361 0.25
362 0.28
363 0.32
364 0.34
365 0.36
366 0.33
367 0.31
368 0.28
369 0.24
370 0.2
371 0.14
372 0.11
373 0.1
374 0.08
375 0.06
376 0.05
377 0.04
378 0.05
379 0.08
380 0.07
381 0.08
382 0.08
383 0.09
384 0.11
385 0.12
386 0.13
387 0.11
388 0.12
389 0.11
390 0.11
391 0.1
392 0.08
393 0.06
394 0.05
395 0.04
396 0.05
397 0.05
398 0.05
399 0.06
400 0.06
401 0.07
402 0.08
403 0.08
404 0.06
405 0.06
406 0.09
407 0.13
408 0.13
409 0.13
410 0.12
411 0.13
412 0.13
413 0.14
414 0.13
415 0.09
416 0.1
417 0.11
418 0.13
419 0.17
420 0.24
421 0.33
422 0.37
423 0.46
424 0.53
425 0.59
426 0.65
427 0.62
428 0.65
429 0.57
430 0.53
431 0.49
432 0.5
433 0.45
434 0.4
435 0.38
436 0.28
437 0.31
438 0.32
439 0.27
440 0.19
441 0.19
442 0.17
443 0.16
444 0.16
445 0.11
446 0.11
447 0.1
448 0.1
449 0.07
450 0.15
451 0.15
452 0.15
453 0.15
454 0.15
455 0.17
456 0.17
457 0.17
458 0.09
459 0.09
460 0.09
461 0.09
462 0.08
463 0.06
464 0.06
465 0.06
466 0.06
467 0.06
468 0.06
469 0.07
470 0.07
471 0.08
472 0.09
473 0.09
474 0.09
475 0.1
476 0.1
477 0.1
478 0.1
479 0.09
480 0.09
481 0.09
482 0.1
483 0.08
484 0.08
485 0.08
486 0.06
487 0.06
488 0.06
489 0.06
490 0.05
491 0.05
492 0.05
493 0.05
494 0.05
495 0.06
496 0.05
497 0.05
498 0.05
499 0.1
500 0.13
501 0.14
502 0.14
503 0.19
504 0.26
505 0.3
506 0.33
507 0.32
508 0.38
509 0.46
510 0.53
511 0.53
512 0.49
513 0.46
514 0.44
515 0.4
516 0.32
517 0.23
518 0.16
519 0.11
520 0.08
521 0.07
522 0.05
523 0.04
524 0.04
525 0.04
526 0.03
527 0.03
528 0.05
529 0.1
530 0.12
531 0.19
532 0.25
533 0.29
534 0.34
535 0.38
536 0.39
537 0.42
538 0.5
539 0.5
540 0.49
541 0.46
542 0.42
543 0.38
544 0.36
545 0.28
546 0.19
547 0.13
548 0.08
549 0.08
550 0.09
551 0.09
552 0.08
553 0.09
554 0.12
555 0.15
556 0.18
557 0.21
558 0.25
559 0.29
560 0.3
561 0.31
562 0.33
563 0.3
564 0.33
565 0.33
566 0.28
567 0.25
568 0.24
569 0.24
570 0.22
571 0.22
572 0.2
573 0.18
574 0.18
575 0.18
576 0.17
577 0.16
578 0.14
579 0.15
580 0.13
581 0.13
582 0.13
583 0.16
584 0.2
585 0.23
586 0.3
587 0.35
588 0.34
589 0.34
590 0.4
591 0.38
592 0.35
593 0.35
594 0.31
595 0.27
596 0.34
597 0.36
598 0.3
599 0.32
600 0.35
601 0.34
602 0.32
603 0.37
604 0.35
605 0.36
606 0.39
607 0.41
608 0.38
609 0.36
610 0.36
611 0.31
612 0.29
613 0.29
614 0.31
615 0.29
616 0.31
617 0.31
618 0.32
619 0.34
620 0.32
621 0.31
622 0.35
623 0.39
624 0.4
625 0.47
626 0.51
627 0.53
628 0.61
629 0.69
630 0.71
631 0.73
632 0.81
633 0.85
634 0.88
635 0.91
636 0.91
637 0.9
638 0.9
639 0.9
640 0.87
641 0.83
642 0.78
643 0.71
644 0.63
645 0.6
646 0.53
647 0.51
648 0.52
649 0.53
650 0.53
651 0.57
652 0.61
653 0.61
654 0.65
655 0.66
656 0.63
657 0.62
658 0.65
659 0.65
660 0.65