Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NHU0

Protein Details
Accession G9NHU0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-46SPVKNDPDQPRPKTPKTPRTPRTPRTPPGNDHHydrophilic
NLS Segment(s)
PositionSequence
152-198RKEELRQRREEDEQRRKLPASAAARGARGAPSGRGARGARGRTRIAP
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013960  DASH_Duo1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF08651  DASH_Duo1  
Amino Acid Sequences MAGEMDLDESDLWTSPVKNDPDQPRPKTPKTPRTPRTPRTPPGNDHHSEPVDRDAMLKRELDGVRKINEVIEGVIGTLQRAGGNMESVSKTVSNASTLLNTWTRILSQTEHNQRLILDPRWKGATDDLAEIEAEALRKQQAEARKAAEEEERKEELRQRREEDEQRRKLPASAAARGARGAPSGRGARGARGRTRIAPGSSRIATRSRYSSSNNASASSSSRGTSGIGRGLGTTRSRYGRAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.2
4 0.23
5 0.26
6 0.35
7 0.43
8 0.51
9 0.61
10 0.65
11 0.68
12 0.73
13 0.76
14 0.79
15 0.81
16 0.81
17 0.82
18 0.87
19 0.83
20 0.85
21 0.89
22 0.86
23 0.86
24 0.85
25 0.82
26 0.81
27 0.81
28 0.76
29 0.73
30 0.73
31 0.64
32 0.59
33 0.58
34 0.5
35 0.44
36 0.39
37 0.34
38 0.27
39 0.25
40 0.24
41 0.21
42 0.22
43 0.23
44 0.21
45 0.18
46 0.25
47 0.26
48 0.27
49 0.29
50 0.3
51 0.3
52 0.31
53 0.3
54 0.23
55 0.23
56 0.19
57 0.14
58 0.1
59 0.08
60 0.07
61 0.08
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.06
69 0.05
70 0.06
71 0.06
72 0.08
73 0.08
74 0.08
75 0.09
76 0.08
77 0.08
78 0.09
79 0.09
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.12
86 0.12
87 0.12
88 0.11
89 0.11
90 0.11
91 0.11
92 0.12
93 0.11
94 0.15
95 0.23
96 0.3
97 0.32
98 0.32
99 0.31
100 0.3
101 0.32
102 0.31
103 0.27
104 0.25
105 0.23
106 0.24
107 0.25
108 0.25
109 0.23
110 0.19
111 0.19
112 0.14
113 0.14
114 0.13
115 0.12
116 0.11
117 0.11
118 0.1
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.1
127 0.16
128 0.19
129 0.21
130 0.23
131 0.24
132 0.24
133 0.26
134 0.28
135 0.26
136 0.26
137 0.29
138 0.28
139 0.28
140 0.29
141 0.35
142 0.38
143 0.42
144 0.45
145 0.44
146 0.46
147 0.54
148 0.61
149 0.65
150 0.67
151 0.67
152 0.64
153 0.63
154 0.59
155 0.53
156 0.46
157 0.43
158 0.38
159 0.34
160 0.36
161 0.34
162 0.34
163 0.32
164 0.3
165 0.23
166 0.19
167 0.16
168 0.12
169 0.15
170 0.17
171 0.17
172 0.22
173 0.22
174 0.27
175 0.33
176 0.39
177 0.39
178 0.42
179 0.45
180 0.42
181 0.47
182 0.46
183 0.42
184 0.4
185 0.38
186 0.4
187 0.39
188 0.37
189 0.34
190 0.33
191 0.33
192 0.33
193 0.35
194 0.32
195 0.34
196 0.38
197 0.44
198 0.47
199 0.5
200 0.47
201 0.43
202 0.41
203 0.38
204 0.36
205 0.31
206 0.26
207 0.19
208 0.19
209 0.18
210 0.18
211 0.2
212 0.19
213 0.2
214 0.19
215 0.19
216 0.19
217 0.21
218 0.24
219 0.24
220 0.25
221 0.27
222 0.3