Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2IU03

Protein Details
Accession A0A1Y2IU03   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-42LPPLQVRVRRARPPRRTWRAAGHydrophilic
NLS Segment(s)
PositionSequence
31-35ARPPR
66-87RRKRGRGYKGGERNAAKGRPES
Subcellular Location(s) mito 18, cyto 4, nucl 2, extr 2
Family & Domain DBs
Amino Acid Sequences MWVWAHVAFLCHQWTRFVPVLPPLQVRVRRARPPRRTWRAAGWHELVRSSVTRLWRAVGVTTYSCRRKRGRGYKGGERNAAKGRPESLEGGAWERRDDQRRRGTRTLANTLHDRRRAVASLRHPPRLHALTRHPTFACVVADEDEDECVIKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.3
4 0.28
5 0.26
6 0.3
7 0.34
8 0.34
9 0.34
10 0.31
11 0.36
12 0.4
13 0.42
14 0.46
15 0.49
16 0.55
17 0.64
18 0.71
19 0.73
20 0.79
21 0.85
22 0.85
23 0.84
24 0.78
25 0.77
26 0.77
27 0.71
28 0.66
29 0.59
30 0.52
31 0.46
32 0.42
33 0.33
34 0.25
35 0.21
36 0.17
37 0.16
38 0.16
39 0.18
40 0.18
41 0.19
42 0.18
43 0.18
44 0.16
45 0.15
46 0.14
47 0.13
48 0.15
49 0.2
50 0.26
51 0.28
52 0.33
53 0.35
54 0.41
55 0.51
56 0.59
57 0.63
58 0.65
59 0.69
60 0.73
61 0.78
62 0.74
63 0.69
64 0.59
65 0.53
66 0.48
67 0.44
68 0.35
69 0.27
70 0.25
71 0.21
72 0.22
73 0.19
74 0.16
75 0.15
76 0.14
77 0.16
78 0.17
79 0.15
80 0.14
81 0.15
82 0.2
83 0.28
84 0.31
85 0.37
86 0.45
87 0.53
88 0.6
89 0.62
90 0.62
91 0.59
92 0.62
93 0.62
94 0.55
95 0.51
96 0.5
97 0.53
98 0.54
99 0.52
100 0.46
101 0.39
102 0.4
103 0.4
104 0.37
105 0.38
106 0.39
107 0.45
108 0.5
109 0.57
110 0.53
111 0.52
112 0.56
113 0.54
114 0.5
115 0.46
116 0.5
117 0.52
118 0.54
119 0.57
120 0.49
121 0.45
122 0.42
123 0.38
124 0.3
125 0.21
126 0.21
127 0.17
128 0.18
129 0.17
130 0.16
131 0.13
132 0.12