Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2J175

Protein Details
Accession A0A1Y2J175   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-111MGQEYQPSQRKRKRKHGFLSRKRSVNGHydrophilic
NLS Segment(s)
PositionSequence
94-123RKRKRKHGFLSRKRSVNGRKMLARRRAKGR
Subcellular Location(s) mito_nucl 11.666, nucl 11, mito 11, cyto_nucl 8.166, cyto_mito 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLPPSIARLFARPPALPSVSAISRAATSSTSFISSVTPLRPFLPSSTSSTSLLPLGSLLSRLNLDFSVPSIFSPVLQVRHNTMGQEYQPSQRKRKRKHGFLSRKRSVNGRKMLARRRAKGRLYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.33
4 0.32
5 0.29
6 0.28
7 0.27
8 0.24
9 0.25
10 0.23
11 0.18
12 0.16
13 0.16
14 0.15
15 0.11
16 0.12
17 0.11
18 0.11
19 0.12
20 0.11
21 0.11
22 0.11
23 0.12
24 0.13
25 0.14
26 0.14
27 0.14
28 0.15
29 0.16
30 0.17
31 0.16
32 0.18
33 0.17
34 0.21
35 0.24
36 0.26
37 0.25
38 0.25
39 0.24
40 0.21
41 0.18
42 0.12
43 0.08
44 0.07
45 0.05
46 0.06
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.06
56 0.07
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.1
63 0.11
64 0.13
65 0.14
66 0.15
67 0.17
68 0.21
69 0.21
70 0.19
71 0.18
72 0.18
73 0.17
74 0.22
75 0.21
76 0.24
77 0.32
78 0.37
79 0.46
80 0.52
81 0.62
82 0.66
83 0.76
84 0.79
85 0.81
86 0.87
87 0.88
88 0.91
89 0.92
90 0.93
91 0.9
92 0.86
93 0.77
94 0.76
95 0.74
96 0.72
97 0.7
98 0.67
99 0.67
100 0.7
101 0.78
102 0.78
103 0.78
104 0.77
105 0.78
106 0.79
107 0.76
108 0.76