Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2IQR8

Protein Details
Accession A0A1Y2IQR8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MVKVPIVKKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
8-51KKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) nucl 14.5, mito_nucl 13, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVKVPIVKKRTKPFKRHQSDRYKSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKFLVSNVREVDLLLMHNKSFAAEIAHNVSSRNRTLILERAKVLGVKVTNPTARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.92
4 0.91
5 0.91
6 0.89
7 0.88
8 0.86
9 0.79
10 0.71
11 0.69
12 0.67
13 0.66
14 0.68
15 0.69
16 0.69
17 0.67
18 0.67
19 0.67
20 0.69
21 0.7
22 0.69
23 0.69
24 0.71
25 0.79
26 0.83
27 0.76
28 0.73
29 0.71
30 0.68
31 0.67
32 0.64
33 0.64
34 0.64
35 0.66
36 0.59
37 0.52
38 0.46
39 0.38
40 0.37
41 0.33
42 0.35
43 0.4
44 0.41
45 0.42
46 0.45
47 0.47
48 0.47
49 0.45
50 0.47
51 0.45
52 0.53
53 0.54
54 0.52
55 0.47
56 0.4
57 0.36
58 0.32
59 0.31
60 0.22
61 0.24
62 0.25
63 0.26
64 0.25
65 0.24
66 0.2
67 0.13
68 0.13
69 0.1
70 0.09
71 0.08
72 0.08
73 0.08
74 0.08
75 0.08
76 0.07
77 0.09
78 0.09
79 0.11
80 0.15
81 0.16
82 0.16
83 0.17
84 0.19
85 0.19
86 0.2
87 0.2
88 0.17
89 0.18
90 0.21
91 0.29
92 0.33
93 0.33
94 0.33
95 0.33
96 0.32
97 0.31
98 0.29
99 0.26
100 0.2
101 0.19
102 0.22
103 0.27
104 0.28
105 0.29
106 0.34
107 0.32