Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E6X3

Protein Details
Accession A0A1W0E6X3   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-108ERVEIKQKNIRKPSFKNPLQNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto_nucl 5.5, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MLRKKNVACFFPIKYTQKYSSPNSFLSYGTYTSFDIVNTSNEKTHKDILCKYFLYGKCDRENCEFSHKLKDFSDEHILNMLNEHIEERVEIKQKNIRKPSFKNPLQNLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.51
4 0.52
5 0.55
6 0.55
7 0.55
8 0.54
9 0.5
10 0.47
11 0.44
12 0.37
13 0.34
14 0.3
15 0.22
16 0.19
17 0.19
18 0.16
19 0.15
20 0.15
21 0.11
22 0.11
23 0.1
24 0.12
25 0.12
26 0.13
27 0.15
28 0.16
29 0.19
30 0.2
31 0.26
32 0.26
33 0.28
34 0.32
35 0.33
36 0.36
37 0.34
38 0.32
39 0.32
40 0.32
41 0.33
42 0.32
43 0.32
44 0.34
45 0.36
46 0.38
47 0.36
48 0.37
49 0.33
50 0.37
51 0.36
52 0.32
53 0.41
54 0.38
55 0.36
56 0.34
57 0.37
58 0.3
59 0.32
60 0.39
61 0.29
62 0.28
63 0.28
64 0.27
65 0.22
66 0.21
67 0.17
68 0.08
69 0.08
70 0.08
71 0.06
72 0.06
73 0.07
74 0.08
75 0.14
76 0.2
77 0.2
78 0.25
79 0.32
80 0.39
81 0.49
82 0.57
83 0.6
84 0.64
85 0.71
86 0.77
87 0.81
88 0.81
89 0.82