Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E509

Protein Details
Accession A0A1W0E509    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-125VMVCCKEHYKNKKIRIKDNKENKEINIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLYTNINIIDNIIIKEYNTNICNNTNICNNTNICNTCNICNTCNNGMYDIIPLNYVSFQINTETTSYYDIIYKDSTNTHTLVNTVKMIPTTYPTEILLVMVCCKEHYKNKKIRIKDNKENKEINIIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.15
4 0.19
5 0.18
6 0.2
7 0.21
8 0.23
9 0.26
10 0.25
11 0.26
12 0.27
13 0.29
14 0.28
15 0.3
16 0.3
17 0.3
18 0.34
19 0.33
20 0.27
21 0.3
22 0.3
23 0.28
24 0.33
25 0.32
26 0.28
27 0.3
28 0.34
29 0.31
30 0.32
31 0.3
32 0.24
33 0.22
34 0.21
35 0.19
36 0.14
37 0.11
38 0.09
39 0.08
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.1
53 0.1
54 0.09
55 0.11
56 0.1
57 0.11
58 0.11
59 0.11
60 0.1
61 0.12
62 0.14
63 0.14
64 0.14
65 0.13
66 0.13
67 0.13
68 0.14
69 0.14
70 0.13
71 0.12
72 0.11
73 0.11
74 0.12
75 0.11
76 0.13
77 0.15
78 0.15
79 0.16
80 0.16
81 0.16
82 0.15
83 0.15
84 0.13
85 0.09
86 0.1
87 0.09
88 0.09
89 0.09
90 0.12
91 0.18
92 0.27
93 0.36
94 0.45
95 0.54
96 0.65
97 0.72
98 0.78
99 0.83
100 0.84
101 0.85
102 0.85
103 0.87
104 0.87
105 0.86
106 0.82
107 0.73