Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E677

Protein Details
Accession A0A1W0E677    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
30-51NKEIRIKNTKKRKCDNCTCSRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007785  Anamorsin  
IPR046408  CIAPIN1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF05093  CIAPIN1  
Amino Acid Sequences MEDELKKLLEEATNIQIDPRNNEADQKEENKEIRIKNTKKRKCDNCTCSRATADEKPKSNCGNCYLGDAFRCSGCPYKGLPAFNEGEEISFDQNDLNDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.24
5 0.26
6 0.26
7 0.24
8 0.23
9 0.29
10 0.28
11 0.29
12 0.32
13 0.33
14 0.32
15 0.33
16 0.34
17 0.33
18 0.38
19 0.36
20 0.4
21 0.45
22 0.49
23 0.53
24 0.63
25 0.67
26 0.7
27 0.78
28 0.79
29 0.78
30 0.82
31 0.82
32 0.8
33 0.8
34 0.72
35 0.64
36 0.55
37 0.48
38 0.41
39 0.39
40 0.39
41 0.38
42 0.4
43 0.41
44 0.44
45 0.46
46 0.43
47 0.39
48 0.34
49 0.32
50 0.28
51 0.3
52 0.27
53 0.25
54 0.24
55 0.23
56 0.19
57 0.16
58 0.17
59 0.14
60 0.18
61 0.17
62 0.18
63 0.18
64 0.26
65 0.31
66 0.32
67 0.31
68 0.31
69 0.32
70 0.3
71 0.31
72 0.22
73 0.18
74 0.18
75 0.18
76 0.15
77 0.13
78 0.13
79 0.11