Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E614

Protein Details
Accession A0A1W0E614   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-47NIPKEKKHYCVKCNKHTENKISHydrophilic
73-100GQTKPILRRKAKNTKKPVLKLKCTKCSAHydrophilic
NLS Segment(s)
PositionSequence
50-90KKGKDNPKREGNRRYAIKQRGFGGQTKPILRRKAKNTKKPV
Subcellular Location(s) nucl 16, mito_nucl 13.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MFKKTCIYTHFKNYKNSFYKFYPMVNIPKEKKHYCVKCNKHTENKISIYKKGKDNPKREGNRRYAIKQRGFGGQTKPILRRKAKNTKKPVLKLKCTKCSAMQMKPLHRAKQTILSNEKKVKGAALTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.68
4 0.63
5 0.57
6 0.58
7 0.5
8 0.47
9 0.42
10 0.39
11 0.43
12 0.43
13 0.48
14 0.45
15 0.51
16 0.57
17 0.53
18 0.54
19 0.57
20 0.6
21 0.6
22 0.68
23 0.69
24 0.72
25 0.8
26 0.82
27 0.82
28 0.81
29 0.78
30 0.74
31 0.71
32 0.69
33 0.62
34 0.6
35 0.57
36 0.55
37 0.55
38 0.55
39 0.59
40 0.6
41 0.64
42 0.66
43 0.69
44 0.73
45 0.74
46 0.75
47 0.72
48 0.71
49 0.68
50 0.63
51 0.62
52 0.62
53 0.57
54 0.51
55 0.46
56 0.43
57 0.41
58 0.4
59 0.35
60 0.31
61 0.32
62 0.33
63 0.37
64 0.38
65 0.45
66 0.47
67 0.52
68 0.57
69 0.64
70 0.7
71 0.75
72 0.79
73 0.8
74 0.84
75 0.84
76 0.85
77 0.83
78 0.83
79 0.83
80 0.82
81 0.82
82 0.76
83 0.71
84 0.64
85 0.65
86 0.62
87 0.59
88 0.58
89 0.57
90 0.6
91 0.66
92 0.69
93 0.65
94 0.6
95 0.57
96 0.52
97 0.54
98 0.53
99 0.53
100 0.55
101 0.56
102 0.61
103 0.65
104 0.64
105 0.57
106 0.51
107 0.45