Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E5L0

Protein Details
Accession A0A1W0E5L0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
101-127KGSNASNPKQKIKKKFKAQNKMLEKELHydrophilic
NLS Segment(s)
PositionSequence
90-137GDIKRNRSLKGKGSNASNPKQKIKKKFKAQNKMLEKELNNIGKKSKKF
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 10.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSKNIEKTENNADIKTIVKDAEIKVKGLKVEVLKHFLKTFILSNKNEIDFKQMENNHNVKKMKEMTVLFKKLLEIEKNFTDVKLERKAVGDIKRNRSLKGKGSNASNPKQKIKKKFKAQNKMLEKELNNIGKKSKKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.23
4 0.15
5 0.14
6 0.17
7 0.18
8 0.27
9 0.26
10 0.25
11 0.26
12 0.28
13 0.27
14 0.25
15 0.27
16 0.21
17 0.27
18 0.29
19 0.33
20 0.31
21 0.33
22 0.32
23 0.29
24 0.26
25 0.21
26 0.22
27 0.23
28 0.29
29 0.28
30 0.31
31 0.34
32 0.35
33 0.34
34 0.29
35 0.28
36 0.22
37 0.22
38 0.26
39 0.27
40 0.28
41 0.34
42 0.39
43 0.35
44 0.4
45 0.4
46 0.33
47 0.35
48 0.35
49 0.31
50 0.32
51 0.3
52 0.32
53 0.38
54 0.4
55 0.34
56 0.31
57 0.29
58 0.25
59 0.27
60 0.23
61 0.17
62 0.19
63 0.19
64 0.22
65 0.22
66 0.19
67 0.19
68 0.17
69 0.2
70 0.23
71 0.23
72 0.21
73 0.22
74 0.25
75 0.28
76 0.34
77 0.38
78 0.4
79 0.47
80 0.55
81 0.55
82 0.55
83 0.56
84 0.55
85 0.54
86 0.55
87 0.54
88 0.49
89 0.54
90 0.6
91 0.6
92 0.62
93 0.62
94 0.57
95 0.6
96 0.66
97 0.68
98 0.71
99 0.75
100 0.78
101 0.81
102 0.87
103 0.88
104 0.9
105 0.9
106 0.9
107 0.88
108 0.83
109 0.76
110 0.74
111 0.64
112 0.58
113 0.58
114 0.56
115 0.49
116 0.47
117 0.49