Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E4C9

Protein Details
Accession A0A1W0E4C9   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-110RDEEAEDKKRQNKNKTVKKRKKLIKKMKRRABasic
NLS Segment(s)
PositionSequence
87-110KKRQNKNKTVKKRKKLIKKMKRRA
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYIFYINLLFNYLFVINTSGSSNEGACGYASDNSNGGLDGYEEESTNSDSIYESTSSEKESEGNKTSSSTNTEEEENEERDEEAEDKKRQNKNKTVKKRKKLIKKMKRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.09
4 0.1
5 0.11
6 0.1
7 0.11
8 0.11
9 0.11
10 0.1
11 0.1
12 0.09
13 0.08
14 0.08
15 0.08
16 0.1
17 0.11
18 0.11
19 0.11
20 0.11
21 0.11
22 0.11
23 0.09
24 0.06
25 0.06
26 0.06
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.09
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.09
42 0.09
43 0.1
44 0.1
45 0.1
46 0.11
47 0.12
48 0.15
49 0.17
50 0.18
51 0.17
52 0.18
53 0.19
54 0.19
55 0.21
56 0.19
57 0.18
58 0.19
59 0.19
60 0.18
61 0.22
62 0.23
63 0.21
64 0.19
65 0.17
66 0.16
67 0.16
68 0.17
69 0.14
70 0.16
71 0.21
72 0.25
73 0.31
74 0.4
75 0.48
76 0.56
77 0.64
78 0.69
79 0.73
80 0.8
81 0.85
82 0.88
83 0.91
84 0.93
85 0.93
86 0.93
87 0.94
88 0.94
89 0.94
90 0.93