Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E6J1

Protein Details
Accession A0A1W0E6J1    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
375-396ELERKCFYKKFKVNGTNLKPFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 8.5, cyto_nucl 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043519  NT_sf  
IPR002646  PolA_pol_head_dom  
IPR032828  PolyA_RNA-bd  
Gene Ontology GO:0140101  F:catalytic activity, acting on a tRNA  
GO:0016779  F:nucleotidyltransferase activity  
GO:0003723  F:RNA binding  
GO:0001680  P:tRNA 3'-terminal CCA addition  
Pfam View protein in Pfam  
PF01743  PolyA_pol  
PF12627  PolyA_pol_RNAbd  
CDD cd05398  NT_ClassII-CCAase  
Amino Acid Sequences MFLTKNEVKIIEFIKRFALSLSFKTVPRIAGGWVRDKLLGINSDDIDIAIQNISGYKFAELLLEWGNLNKNIHKISANPEKSKHLETAVVHLFGRDVDFVILRTEVYSDTRIPEIRPGTAEEDSLRRDMTINSLFYNIITGCIEDFTGKGLLDLKNGILRTPLSPKQTFLDDPLRILRFFRFHAKFKFFLVSEVCDAIQQNEIQNAFTTKISAERIWKEIYKMLLYPEGTLGLLKLVSLNFIFPIFKFNYQNLCGKSNIFYKKTKRFYHLLENRDYLVLVKIFTIFHVLDAEKCQFIFKEILKAPGFFIKSSTLIYKNFSKIDLIFDERKCIILRNLIFYMLEAKELWKVCFIIYFGINDGFEMEMILKEITVLELERKCFYKKFKVNGTNLKPFLDKQISSMGFYLKVCKMLEVENENLNAEEIIKMALKEYSISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.32
4 0.28
5 0.31
6 0.26
7 0.28
8 0.35
9 0.34
10 0.34
11 0.38
12 0.39
13 0.33
14 0.31
15 0.29
16 0.25
17 0.27
18 0.3
19 0.33
20 0.32
21 0.33
22 0.31
23 0.3
24 0.29
25 0.27
26 0.27
27 0.22
28 0.24
29 0.22
30 0.23
31 0.22
32 0.2
33 0.16
34 0.12
35 0.11
36 0.07
37 0.06
38 0.06
39 0.07
40 0.08
41 0.09
42 0.09
43 0.09
44 0.09
45 0.09
46 0.11
47 0.09
48 0.11
49 0.13
50 0.13
51 0.12
52 0.14
53 0.17
54 0.18
55 0.2
56 0.2
57 0.23
58 0.23
59 0.26
60 0.25
61 0.25
62 0.32
63 0.41
64 0.45
65 0.45
66 0.46
67 0.5
68 0.53
69 0.53
70 0.46
71 0.38
72 0.36
73 0.32
74 0.37
75 0.33
76 0.31
77 0.27
78 0.25
79 0.23
80 0.18
81 0.18
82 0.11
83 0.08
84 0.07
85 0.08
86 0.09
87 0.1
88 0.09
89 0.08
90 0.08
91 0.08
92 0.09
93 0.11
94 0.12
95 0.12
96 0.14
97 0.17
98 0.18
99 0.18
100 0.23
101 0.23
102 0.22
103 0.22
104 0.23
105 0.24
106 0.24
107 0.24
108 0.19
109 0.2
110 0.21
111 0.21
112 0.18
113 0.14
114 0.14
115 0.14
116 0.18
117 0.19
118 0.18
119 0.18
120 0.19
121 0.19
122 0.18
123 0.19
124 0.13
125 0.1
126 0.09
127 0.08
128 0.07
129 0.07
130 0.08
131 0.06
132 0.06
133 0.07
134 0.08
135 0.07
136 0.07
137 0.11
138 0.11
139 0.12
140 0.13
141 0.12
142 0.14
143 0.14
144 0.13
145 0.11
146 0.11
147 0.13
148 0.19
149 0.23
150 0.26
151 0.27
152 0.28
153 0.29
154 0.31
155 0.29
156 0.28
157 0.31
158 0.25
159 0.26
160 0.29
161 0.29
162 0.25
163 0.26
164 0.23
165 0.18
166 0.2
167 0.28
168 0.28
169 0.32
170 0.39
171 0.42
172 0.41
173 0.4
174 0.42
175 0.32
176 0.31
177 0.27
178 0.22
179 0.19
180 0.18
181 0.16
182 0.13
183 0.13
184 0.11
185 0.11
186 0.09
187 0.09
188 0.1
189 0.1
190 0.1
191 0.1
192 0.1
193 0.1
194 0.09
195 0.09
196 0.07
197 0.09
198 0.11
199 0.12
200 0.16
201 0.16
202 0.19
203 0.2
204 0.21
205 0.2
206 0.2
207 0.2
208 0.17
209 0.15
210 0.14
211 0.15
212 0.15
213 0.14
214 0.12
215 0.11
216 0.1
217 0.09
218 0.08
219 0.05
220 0.04
221 0.04
222 0.04
223 0.04
224 0.05
225 0.05
226 0.05
227 0.05
228 0.06
229 0.06
230 0.05
231 0.1
232 0.11
233 0.14
234 0.16
235 0.18
236 0.22
237 0.25
238 0.3
239 0.28
240 0.28
241 0.26
242 0.25
243 0.26
244 0.29
245 0.32
246 0.31
247 0.36
248 0.42
249 0.51
250 0.59
251 0.61
252 0.58
253 0.57
254 0.58
255 0.62
256 0.61
257 0.56
258 0.52
259 0.49
260 0.45
261 0.4
262 0.35
263 0.24
264 0.19
265 0.14
266 0.1
267 0.09
268 0.09
269 0.09
270 0.09
271 0.11
272 0.09
273 0.09
274 0.11
275 0.11
276 0.11
277 0.14
278 0.15
279 0.12
280 0.12
281 0.13
282 0.1
283 0.13
284 0.16
285 0.14
286 0.22
287 0.23
288 0.3
289 0.3
290 0.3
291 0.29
292 0.3
293 0.3
294 0.22
295 0.22
296 0.18
297 0.18
298 0.19
299 0.22
300 0.2
301 0.2
302 0.23
303 0.27
304 0.28
305 0.28
306 0.27
307 0.25
308 0.23
309 0.26
310 0.26
311 0.26
312 0.29
313 0.29
314 0.32
315 0.3
316 0.32
317 0.28
318 0.27
319 0.24
320 0.25
321 0.27
322 0.28
323 0.28
324 0.27
325 0.27
326 0.24
327 0.26
328 0.18
329 0.18
330 0.12
331 0.13
332 0.17
333 0.19
334 0.19
335 0.16
336 0.17
337 0.16
338 0.18
339 0.17
340 0.15
341 0.15
342 0.15
343 0.14
344 0.16
345 0.15
346 0.13
347 0.13
348 0.1
349 0.09
350 0.08
351 0.07
352 0.06
353 0.07
354 0.07
355 0.06
356 0.06
357 0.06
358 0.06
359 0.06
360 0.07
361 0.12
362 0.16
363 0.18
364 0.21
365 0.24
366 0.27
367 0.32
368 0.39
369 0.44
370 0.49
371 0.56
372 0.64
373 0.71
374 0.77
375 0.83
376 0.84
377 0.82
378 0.76
379 0.69
380 0.61
381 0.52
382 0.52
383 0.48
384 0.39
385 0.32
386 0.4
387 0.38
388 0.38
389 0.39
390 0.31
391 0.27
392 0.27
393 0.31
394 0.23
395 0.26
396 0.25
397 0.24
398 0.24
399 0.26
400 0.33
401 0.32
402 0.33
403 0.32
404 0.33
405 0.32
406 0.31
407 0.27
408 0.2
409 0.15
410 0.12
411 0.08
412 0.09
413 0.1
414 0.1
415 0.1
416 0.11
417 0.11