Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E978

Protein Details
Accession A0A1W0E978    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-79VIKNEEKFKKCKKIYKKLSRVKNKDLLNHydrophilic
NLS Segment(s)
PositionSequence
61-61K
63-72KKIYKKLSRV
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MEGKYNKEELRKEFNDLQQTFYKFVTDGQELSLKNLLNDHITLYDDKIRSEVIKNEEKFKKCKKIYKKLSRVKNKDLLNKSHFIHEIKKAIFAKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.54
4 0.52
5 0.48
6 0.48
7 0.43
8 0.36
9 0.31
10 0.21
11 0.23
12 0.23
13 0.18
14 0.16
15 0.16
16 0.2
17 0.2
18 0.21
19 0.22
20 0.18
21 0.16
22 0.17
23 0.16
24 0.12
25 0.12
26 0.11
27 0.08
28 0.09
29 0.1
30 0.1
31 0.14
32 0.13
33 0.13
34 0.12
35 0.12
36 0.12
37 0.14
38 0.17
39 0.18
40 0.26
41 0.27
42 0.35
43 0.41
44 0.43
45 0.49
46 0.53
47 0.58
48 0.57
49 0.66
50 0.68
51 0.72
52 0.81
53 0.85
54 0.87
55 0.86
56 0.89
57 0.91
58 0.89
59 0.86
60 0.83
61 0.79
62 0.78
63 0.76
64 0.74
65 0.68
66 0.65
67 0.57
68 0.55
69 0.52
70 0.45
71 0.44
72 0.43
73 0.45
74 0.41
75 0.48
76 0.46