Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E7X3

Protein Details
Accession A0A1W0E7X3   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
8-29INLFYRYKYKCKINISRPSQNHHydrophilic
188-221KGCIKEKERNPEKNDKNIKKTKKTKKYLYFFLFAHydrophilic
NLS Segment(s)
PositionSequence
196-212RNPEKNDKNIKKTKKTK
Subcellular Location(s) cyto 8.5, cyto_mito 7.666, cyto_nucl 7.333, mito 5.5, nucl 4, pero 4, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSYWVTFINLFYRYKYKCKINISRPSQNHLKISCDGTFCIILSLKHNKNIKPLGNKKYIENYKKYIIREEIEYLEDNKNIQSQNINDEINNNVESINNLGFRSNNSNTNVIINTEKNIPISFYIVNTKTLDSHLLKIFLHDKDTILFDSTLEWNNDIININSKTIEKVECIKQEDGTKLEQIDFKNMKGCIKEKERNPEKNDKNIKKTKKTKKYLYFFLFALLLVTFITIGIFGKKKYKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.51
4 0.56
5 0.65
6 0.72
7 0.74
8 0.81
9 0.82
10 0.85
11 0.79
12 0.78
13 0.76
14 0.71
15 0.68
16 0.6
17 0.55
18 0.48
19 0.49
20 0.45
21 0.38
22 0.33
23 0.28
24 0.26
25 0.21
26 0.2
27 0.17
28 0.15
29 0.19
30 0.28
31 0.28
32 0.35
33 0.4
34 0.4
35 0.47
36 0.54
37 0.55
38 0.57
39 0.63
40 0.64
41 0.68
42 0.67
43 0.63
44 0.65
45 0.68
46 0.64
47 0.61
48 0.57
49 0.56
50 0.59
51 0.57
52 0.52
53 0.47
54 0.41
55 0.39
56 0.37
57 0.31
58 0.28
59 0.27
60 0.25
61 0.22
62 0.2
63 0.18
64 0.15
65 0.17
66 0.15
67 0.15
68 0.15
69 0.14
70 0.18
71 0.21
72 0.21
73 0.17
74 0.18
75 0.19
76 0.17
77 0.16
78 0.12
79 0.09
80 0.09
81 0.09
82 0.1
83 0.1
84 0.09
85 0.09
86 0.09
87 0.09
88 0.11
89 0.17
90 0.18
91 0.21
92 0.22
93 0.23
94 0.23
95 0.25
96 0.23
97 0.17
98 0.17
99 0.13
100 0.12
101 0.12
102 0.13
103 0.11
104 0.11
105 0.1
106 0.09
107 0.1
108 0.09
109 0.09
110 0.13
111 0.13
112 0.15
113 0.15
114 0.15
115 0.13
116 0.14
117 0.17
118 0.14
119 0.17
120 0.16
121 0.17
122 0.16
123 0.18
124 0.21
125 0.17
126 0.18
127 0.15
128 0.15
129 0.14
130 0.16
131 0.15
132 0.12
133 0.12
134 0.09
135 0.11
136 0.12
137 0.14
138 0.13
139 0.13
140 0.11
141 0.11
142 0.12
143 0.11
144 0.1
145 0.14
146 0.14
147 0.14
148 0.15
149 0.15
150 0.15
151 0.16
152 0.17
153 0.13
154 0.17
155 0.22
156 0.26
157 0.31
158 0.31
159 0.32
160 0.34
161 0.35
162 0.32
163 0.28
164 0.25
165 0.21
166 0.22
167 0.23
168 0.21
169 0.27
170 0.27
171 0.25
172 0.29
173 0.29
174 0.3
175 0.31
176 0.33
177 0.32
178 0.4
179 0.47
180 0.49
181 0.59
182 0.66
183 0.71
184 0.75
185 0.78
186 0.74
187 0.78
188 0.82
189 0.8
190 0.8
191 0.81
192 0.84
193 0.84
194 0.89
195 0.89
196 0.89
197 0.9
198 0.91
199 0.91
200 0.9
201 0.89
202 0.84
203 0.77
204 0.66
205 0.58
206 0.47
207 0.36
208 0.29
209 0.18
210 0.12
211 0.08
212 0.08
213 0.06
214 0.05
215 0.05
216 0.04
217 0.05
218 0.1
219 0.13
220 0.15
221 0.24