Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E8K0

Protein Details
Accession A0A1W0E8K0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAKKKSRRTTIKKRTYKIPINKYNCPKCNHydrophilic
NLS Segment(s)
PositionSequence
3-13KKKSRRTTIKK
Subcellular Location(s) mito_nucl 13, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MAKKKSRRTTIKKRTYKIPINKYNCPKCNHEKVVSCKIDNKNQIGTAVCSVCDSQYKCKVTKLDQSVDIYHNWVDEMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.84
4 0.83
5 0.82
6 0.82
7 0.79
8 0.83
9 0.83
10 0.83
11 0.79
12 0.73
13 0.69
14 0.67
15 0.7
16 0.67
17 0.63
18 0.6
19 0.61
20 0.67
21 0.62
22 0.55
23 0.52
24 0.5
25 0.51
26 0.47
27 0.43
28 0.35
29 0.33
30 0.33
31 0.26
32 0.23
33 0.19
34 0.15
35 0.13
36 0.11
37 0.11
38 0.11
39 0.15
40 0.16
41 0.21
42 0.29
43 0.33
44 0.33
45 0.38
46 0.42
47 0.43
48 0.5
49 0.5
50 0.47
51 0.49
52 0.51
53 0.49
54 0.46
55 0.42
56 0.35
57 0.28
58 0.23