Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E7S4

Protein Details
Accession A0A1W0E7S4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-98GWGFYRRNPMKFKKAKKDSKKEELLNKNKHydrophilic
NLS Segment(s)
PositionSequence
76-98RNPMKFKKAKKDSKKEELLNKNK
Subcellular Location(s) plas 12, mito 7, E.R. 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MKDILKRLLNYIDPVIDYQGQHLNFLLMHGIFICGFLIAFTTGIILNDLKYTLYVAIVVIILNAFITLPGWGFYRRNPMKFKKAKKDSKKEELLNKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.17
5 0.17
6 0.21
7 0.19
8 0.19
9 0.18
10 0.16
11 0.14
12 0.14
13 0.13
14 0.07
15 0.07
16 0.06
17 0.07
18 0.06
19 0.06
20 0.06
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.04
57 0.06
58 0.09
59 0.1
60 0.12
61 0.23
62 0.29
63 0.35
64 0.43
65 0.5
66 0.58
67 0.67
68 0.76
69 0.76
70 0.81
71 0.86
72 0.89
73 0.92
74 0.91
75 0.92
76 0.91
77 0.88
78 0.87