Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E4S8

Protein Details
Accession A0A1W0E4S8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
99-121SIPMKKENKKGKLSTFRPKLKNFHydrophilic
NLS Segment(s)
PositionSequence
106-109NKKG
Subcellular Location(s) nucl 17.5, cyto_nucl 13.333, cyto 8, cyto_pero 4.833
Family & Domain DBs
Amino Acid Sequences MTDQEEFDKDKLKLLENNLNKQFVEITKKVESVLNGNKNIKTTEDDEPELSLEQIYSVLEEVSEIVNNHLDVNHVNIQKIKSKADENIDYLRILDGKISIPMKKENKKGKLSTFRPKLKNFIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.47
3 0.47
4 0.56
5 0.54
6 0.54
7 0.49
8 0.45
9 0.4
10 0.34
11 0.36
12 0.28
13 0.29
14 0.29
15 0.3
16 0.3
17 0.29
18 0.26
19 0.25
20 0.33
21 0.34
22 0.36
23 0.39
24 0.39
25 0.38
26 0.38
27 0.32
28 0.26
29 0.24
30 0.25
31 0.26
32 0.26
33 0.25
34 0.25
35 0.24
36 0.21
37 0.17
38 0.11
39 0.07
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.1
60 0.15
61 0.16
62 0.16
63 0.19
64 0.2
65 0.26
66 0.28
67 0.25
68 0.23
69 0.25
70 0.28
71 0.33
72 0.34
73 0.32
74 0.33
75 0.32
76 0.29
77 0.27
78 0.23
79 0.17
80 0.14
81 0.11
82 0.08
83 0.08
84 0.13
85 0.15
86 0.16
87 0.19
88 0.28
89 0.37
90 0.44
91 0.53
92 0.58
93 0.65
94 0.72
95 0.76
96 0.78
97 0.8
98 0.8
99 0.81
100 0.82
101 0.82
102 0.82
103 0.8