Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E578

Protein Details
Accession A0A1W0E578    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-26IEIFKMKKLLKKLRDARGNGTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 12, nucl 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR042226  eFR1_2_sf  
IPR005140  eRF1_1_Pelota  
IPR024049  eRF1_1_sf  
IPR005141  eRF1_2  
IPR005142  eRF1_3  
IPR029064  L30e-like  
IPR004403  Peptide_chain-rel_eRF1/aRF1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF03463  eRF1_1  
PF03464  eRF1_2  
PF03465  eRF1_3  
Amino Acid Sequences MAFDDIEIFKMKKLLKKLRDARGNGTSMISLILPPKEQIPRITKMLTDEYGTATNIKSKVNRLSVLTAISSAQIKLRTYTRTPPNGLGIFVGEILQDDNKVKKVAYGIEPLKPVNTSLYMCDSRFHVEDLLGLFEDEAKYGFVVMDGHGTLFATLQGSTPTILQTISVDLPKKHGRGGQSSVRFARLRVEKRQAYLKKVSEICTSLFLSNNKSNVDGIVLAGQADFKNELKLIMDARLTVLKTVDTNYGGKNGLNQAIELSEDLFKDVKYAKEKKLLQEFFHEINMDTGKYCYGFKGTMDALESGAVEKLIVNENYDKMHEEEEFVDWIAEHYKEYGCELFFVSDTSGEGTQFLEGFGGIGGILRYKIEMAEFDDDENDMSSLSVEEDDIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.53
3 0.64
4 0.72
5 0.77
6 0.82
7 0.8
8 0.78
9 0.75
10 0.69
11 0.59
12 0.51
13 0.4
14 0.31
15 0.27
16 0.19
17 0.13
18 0.14
19 0.14
20 0.14
21 0.14
22 0.2
23 0.24
24 0.27
25 0.33
26 0.36
27 0.4
28 0.44
29 0.44
30 0.4
31 0.4
32 0.42
33 0.36
34 0.31
35 0.27
36 0.25
37 0.25
38 0.24
39 0.21
40 0.16
41 0.2
42 0.2
43 0.23
44 0.24
45 0.28
46 0.36
47 0.4
48 0.42
49 0.4
50 0.41
51 0.39
52 0.38
53 0.32
54 0.24
55 0.19
56 0.18
57 0.16
58 0.13
59 0.14
60 0.15
61 0.15
62 0.18
63 0.22
64 0.26
65 0.29
66 0.38
67 0.44
68 0.48
69 0.51
70 0.51
71 0.53
72 0.49
73 0.45
74 0.36
75 0.28
76 0.21
77 0.17
78 0.14
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.09
85 0.11
86 0.13
87 0.14
88 0.14
89 0.15
90 0.17
91 0.21
92 0.23
93 0.29
94 0.3
95 0.33
96 0.34
97 0.33
98 0.31
99 0.27
100 0.23
101 0.17
102 0.17
103 0.13
104 0.14
105 0.2
106 0.21
107 0.21
108 0.21
109 0.21
110 0.21
111 0.21
112 0.21
113 0.15
114 0.13
115 0.14
116 0.14
117 0.13
118 0.1
119 0.09
120 0.08
121 0.08
122 0.08
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.04
130 0.05
131 0.05
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.05
143 0.05
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.08
154 0.1
155 0.11
156 0.11
157 0.17
158 0.2
159 0.21
160 0.21
161 0.23
162 0.24
163 0.27
164 0.32
165 0.35
166 0.35
167 0.38
168 0.36
169 0.38
170 0.35
171 0.3
172 0.32
173 0.32
174 0.33
175 0.37
176 0.44
177 0.42
178 0.44
179 0.53
180 0.49
181 0.47
182 0.49
183 0.44
184 0.41
185 0.42
186 0.42
187 0.35
188 0.33
189 0.28
190 0.24
191 0.23
192 0.18
193 0.18
194 0.17
195 0.2
196 0.21
197 0.22
198 0.2
199 0.19
200 0.18
201 0.16
202 0.15
203 0.1
204 0.08
205 0.07
206 0.06
207 0.05
208 0.05
209 0.06
210 0.05
211 0.06
212 0.07
213 0.06
214 0.07
215 0.07
216 0.08
217 0.08
218 0.09
219 0.09
220 0.1
221 0.1
222 0.09
223 0.1
224 0.12
225 0.11
226 0.1
227 0.1
228 0.08
229 0.09
230 0.11
231 0.12
232 0.11
233 0.13
234 0.13
235 0.15
236 0.15
237 0.15
238 0.16
239 0.16
240 0.17
241 0.16
242 0.15
243 0.13
244 0.13
245 0.13
246 0.11
247 0.09
248 0.07
249 0.07
250 0.09
251 0.09
252 0.08
253 0.1
254 0.13
255 0.16
256 0.24
257 0.3
258 0.34
259 0.42
260 0.46
261 0.51
262 0.6
263 0.59
264 0.52
265 0.52
266 0.52
267 0.44
268 0.43
269 0.36
270 0.25
271 0.24
272 0.23
273 0.17
274 0.13
275 0.12
276 0.11
277 0.11
278 0.11
279 0.1
280 0.11
281 0.12
282 0.11
283 0.16
284 0.15
285 0.16
286 0.17
287 0.16
288 0.14
289 0.14
290 0.13
291 0.09
292 0.09
293 0.08
294 0.06
295 0.06
296 0.07
297 0.12
298 0.12
299 0.14
300 0.16
301 0.18
302 0.19
303 0.2
304 0.2
305 0.17
306 0.19
307 0.17
308 0.16
309 0.16
310 0.17
311 0.17
312 0.15
313 0.13
314 0.11
315 0.12
316 0.12
317 0.11
318 0.1
319 0.11
320 0.12
321 0.12
322 0.15
323 0.17
324 0.14
325 0.15
326 0.16
327 0.15
328 0.14
329 0.15
330 0.13
331 0.11
332 0.11
333 0.12
334 0.12
335 0.1
336 0.11
337 0.1
338 0.1
339 0.1
340 0.09
341 0.07
342 0.06
343 0.06
344 0.06
345 0.05
346 0.04
347 0.05
348 0.05
349 0.06
350 0.06
351 0.06
352 0.07
353 0.07
354 0.08
355 0.09
356 0.1
357 0.14
358 0.19
359 0.19
360 0.2
361 0.2
362 0.2
363 0.19
364 0.19
365 0.14
366 0.09
367 0.08
368 0.08
369 0.07
370 0.08
371 0.08