Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E8F5

Protein Details
Accession A0A1W0E8F5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
251-277IVTSFLTYKHDKKNKKKETKQAPNLDKHydrophilic
NLS Segment(s)
PositionSequence
262-267KKNKKK
Subcellular Location(s) cyto 16, cyto_nucl 13, nucl 8
Family & Domain DBs
Amino Acid Sequences MTYIFKEINEKILKFRKEEQIQLVKYYIDTALKKLTDNKTVFNNKKLILLLNILKYAKNEESKKLLIQVGLSNKINNARTMILDLIDIDFSGEQKVFYRPDKWIGIVLKDILETFDYERILDDNILKTNRGLEKINLTDEKVMHAKEFIIEKDEKPEIKSSEIEYKVVKFNDNIDSEDLLLCLEIYNKKLCSAFVNIFCSCDKFNSSGNQLLLNLVAYIDKMSFLNYDFYSFLRKIKMNFLENKSMKMEDIVTSFLTYKHDKKNKKKETKQAPNLDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.58
4 0.57
5 0.62
6 0.63
7 0.64
8 0.62
9 0.6
10 0.54
11 0.43
12 0.38
13 0.33
14 0.25
15 0.21
16 0.21
17 0.21
18 0.25
19 0.26
20 0.28
21 0.35
22 0.38
23 0.41
24 0.42
25 0.43
26 0.46
27 0.56
28 0.59
29 0.56
30 0.56
31 0.47
32 0.49
33 0.47
34 0.39
35 0.31
36 0.32
37 0.3
38 0.27
39 0.3
40 0.26
41 0.26
42 0.25
43 0.27
44 0.27
45 0.31
46 0.32
47 0.33
48 0.38
49 0.4
50 0.4
51 0.39
52 0.36
53 0.28
54 0.27
55 0.28
56 0.27
57 0.3
58 0.29
59 0.25
60 0.25
61 0.3
62 0.29
63 0.25
64 0.22
65 0.18
66 0.18
67 0.19
68 0.18
69 0.13
70 0.11
71 0.11
72 0.09
73 0.08
74 0.07
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.05
81 0.07
82 0.1
83 0.13
84 0.15
85 0.18
86 0.19
87 0.24
88 0.25
89 0.25
90 0.27
91 0.25
92 0.24
93 0.22
94 0.21
95 0.16
96 0.14
97 0.13
98 0.09
99 0.08
100 0.07
101 0.07
102 0.09
103 0.09
104 0.09
105 0.09
106 0.09
107 0.09
108 0.09
109 0.09
110 0.08
111 0.12
112 0.12
113 0.12
114 0.12
115 0.16
116 0.16
117 0.17
118 0.17
119 0.15
120 0.19
121 0.21
122 0.24
123 0.2
124 0.19
125 0.18
126 0.17
127 0.18
128 0.15
129 0.14
130 0.11
131 0.11
132 0.1
133 0.1
134 0.12
135 0.1
136 0.12
137 0.13
138 0.13
139 0.17
140 0.2
141 0.18
142 0.18
143 0.22
144 0.2
145 0.21
146 0.22
147 0.2
148 0.26
149 0.27
150 0.26
151 0.23
152 0.24
153 0.26
154 0.26
155 0.24
156 0.16
157 0.18
158 0.23
159 0.24
160 0.23
161 0.2
162 0.2
163 0.19
164 0.19
165 0.15
166 0.09
167 0.08
168 0.06
169 0.04
170 0.06
171 0.07
172 0.09
173 0.12
174 0.13
175 0.15
176 0.15
177 0.16
178 0.17
179 0.21
180 0.24
181 0.26
182 0.3
183 0.29
184 0.3
185 0.3
186 0.29
187 0.24
188 0.21
189 0.18
190 0.16
191 0.19
192 0.22
193 0.26
194 0.28
195 0.28
196 0.28
197 0.25
198 0.23
199 0.2
200 0.16
201 0.12
202 0.07
203 0.06
204 0.05
205 0.06
206 0.05
207 0.06
208 0.06
209 0.07
210 0.07
211 0.09
212 0.13
213 0.12
214 0.14
215 0.14
216 0.15
217 0.2
218 0.2
219 0.22
220 0.24
221 0.26
222 0.26
223 0.35
224 0.42
225 0.44
226 0.52
227 0.55
228 0.6
229 0.58
230 0.59
231 0.53
232 0.46
233 0.39
234 0.32
235 0.28
236 0.2
237 0.2
238 0.19
239 0.17
240 0.17
241 0.17
242 0.17
243 0.2
244 0.23
245 0.28
246 0.37
247 0.46
248 0.56
249 0.66
250 0.77
251 0.83
252 0.89
253 0.92
254 0.92
255 0.94
256 0.95
257 0.94