Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E805

Protein Details
Accession A0A1W0E805    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-55MIDIKNKGKGKRQSKKNVKPLSEEHydrophilic
180-207HGSGCKPPKPDCCKKFPKLKICYRWPSSHydrophilic
NLS Segment(s)
PositionSequence
37-50NKGKGKRQSKKNVK
82-93KPLKPGLTKPGK
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLINTILIKLINTANIPLSSSGVTLSPAAQEMIDIKNKGKGKRQSKKNVKPLSEEPVETTPEKPKEPEQPEEPVPEKPTPEKPLKPGLTKPGKPDLTKPGKPDSNKPETDSEESKPDSNKPETDSEQTNSNKPETDSEQTTSSKPSQSSKSSKSSKSSKNSQSSKSSKSSKSSHCSKSSHGSGCKPPKPDCCKKFPKLKICYRWPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.15
5 0.16
6 0.14
7 0.13
8 0.12
9 0.1
10 0.11
11 0.1
12 0.1
13 0.09
14 0.09
15 0.09
16 0.08
17 0.08
18 0.09
19 0.13
20 0.17
21 0.17
22 0.18
23 0.24
24 0.3
25 0.34
26 0.41
27 0.47
28 0.54
29 0.63
30 0.73
31 0.77
32 0.84
33 0.9
34 0.91
35 0.9
36 0.82
37 0.79
38 0.73
39 0.69
40 0.61
41 0.51
42 0.44
43 0.37
44 0.37
45 0.3
46 0.28
47 0.28
48 0.28
49 0.29
50 0.28
51 0.3
52 0.37
53 0.41
54 0.44
55 0.4
56 0.42
57 0.43
58 0.46
59 0.43
60 0.35
61 0.34
62 0.3
63 0.28
64 0.27
65 0.31
66 0.32
67 0.37
68 0.37
69 0.37
70 0.45
71 0.48
72 0.48
73 0.45
74 0.49
75 0.51
76 0.5
77 0.51
78 0.5
79 0.5
80 0.47
81 0.47
82 0.48
83 0.48
84 0.48
85 0.47
86 0.45
87 0.46
88 0.47
89 0.51
90 0.48
91 0.47
92 0.45
93 0.45
94 0.41
95 0.4
96 0.42
97 0.37
98 0.31
99 0.27
100 0.27
101 0.26
102 0.24
103 0.24
104 0.25
105 0.25
106 0.25
107 0.24
108 0.27
109 0.28
110 0.31
111 0.31
112 0.27
113 0.31
114 0.31
115 0.32
116 0.29
117 0.27
118 0.25
119 0.22
120 0.25
121 0.23
122 0.25
123 0.25
124 0.25
125 0.27
126 0.28
127 0.28
128 0.28
129 0.25
130 0.24
131 0.23
132 0.26
133 0.29
134 0.35
135 0.42
136 0.44
137 0.51
138 0.55
139 0.58
140 0.6
141 0.64
142 0.65
143 0.65
144 0.7
145 0.7
146 0.73
147 0.75
148 0.73
149 0.74
150 0.71
151 0.69
152 0.68
153 0.66
154 0.6
155 0.61
156 0.63
157 0.62
158 0.64
159 0.68
160 0.68
161 0.67
162 0.65
163 0.63
164 0.64
165 0.63
166 0.63
167 0.59
168 0.58
169 0.61
170 0.68
171 0.69
172 0.66
173 0.65
174 0.67
175 0.71
176 0.76
177 0.73
178 0.73
179 0.78
180 0.81
181 0.85
182 0.85
183 0.85
184 0.84
185 0.88
186 0.88
187 0.88