Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E5V7

Protein Details
Accession A0A1W0E5V7    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
57-77VSYFIYCKKHNKEYKIVYCSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006555  ATP-dep_Helicase_C  
IPR010614  DEAD_2  
IPR045028  DinG/Rad3-like  
IPR010643  HBB  
IPR014013  Helic_SF1/SF2_ATP-bd_DinG/Rad3  
IPR006554  Helicase-like_DEXD_c2  
IPR027417  P-loop_NTPase  
IPR013020  Rad3/Chl1-like  
IPR001945  RAD3/XPD  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0003678  F:DNA helicase activity  
GO:0016818  F:hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF06733  DEAD_2  
PF06777  HBB  
PF13307  Helicase_C_2  
PROSITE View protein in PROSITE  
PS51193  HELICASE_ATP_BIND_2  
Amino Acid Sequences MLFEIEDIPIYFPYDYIYPEQITYIKSLLVSIRKPGHILIEMPSGAGKTISLLSCTVSYFIYCKKHNKEYKIVYCSRTLQEIEKVLKELKSLIAYIEKYIKFDFLAFGLSKRENLCINPVALSGNTEFLCRKMIKNLEGLNCDFYDKRAFDIPKGVYSFTDIKELGKQKGFCPYYAIRETILQCNCIVFSYNYLVDPSIYSIITEKFQNDCFVIFDEAHNIDSNCIESLSIDITRRTLESSTHVLKKLETLIQSHKLLAKDNLLKKQKLKEITSEGIPYYFYKYSSKESNDPIPKNPIEEDIYEFTPGNLRLSNHFISIVKRFLEFLKTKLKSTHLTTETPSSFLKTLEDLTCVDKKALRFCSQRLSVLASNLNFEDAEFYQLKAVMKFASLLSMYSKGFSVIFEPFDSLVHVFNPTLRLYCMDASIAMSHVFKKFRNVIITSGTLSPIEMYPVVLNFTPSAVFEIGVTLEKNQISPVIISKGDDQVVLENNEHGGNYLLDFLEDKTIEVKNKITTSFKIRIDASIVRNYGIFLLNVSKTVPDNVVVFFPSYIYMEQIITLWNETGFIDEFLRHKLIFIETPNNTETDIALKKFKIACDNGRGAMLFSVARGKYPKELILRMVMGVQWLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.18
4 0.21
5 0.2
6 0.2
7 0.22
8 0.22
9 0.22
10 0.22
11 0.19
12 0.16
13 0.15
14 0.17
15 0.2
16 0.25
17 0.26
18 0.31
19 0.36
20 0.36
21 0.38
22 0.37
23 0.37
24 0.33
25 0.32
26 0.28
27 0.28
28 0.26
29 0.25
30 0.24
31 0.19
32 0.17
33 0.15
34 0.11
35 0.07
36 0.11
37 0.12
38 0.13
39 0.13
40 0.15
41 0.16
42 0.16
43 0.16
44 0.12
45 0.12
46 0.14
47 0.2
48 0.26
49 0.3
50 0.4
51 0.47
52 0.57
53 0.65
54 0.7
55 0.74
56 0.77
57 0.81
58 0.81
59 0.78
60 0.71
61 0.67
62 0.65
63 0.57
64 0.51
65 0.43
66 0.38
67 0.37
68 0.41
69 0.4
70 0.36
71 0.37
72 0.35
73 0.34
74 0.3
75 0.26
76 0.23
77 0.21
78 0.19
79 0.19
80 0.21
81 0.21
82 0.23
83 0.3
84 0.27
85 0.27
86 0.27
87 0.26
88 0.21
89 0.21
90 0.2
91 0.12
92 0.16
93 0.14
94 0.14
95 0.18
96 0.18
97 0.21
98 0.21
99 0.23
100 0.21
101 0.22
102 0.27
103 0.25
104 0.25
105 0.22
106 0.22
107 0.2
108 0.18
109 0.19
110 0.13
111 0.14
112 0.13
113 0.14
114 0.14
115 0.13
116 0.19
117 0.18
118 0.19
119 0.24
120 0.3
121 0.31
122 0.37
123 0.43
124 0.43
125 0.45
126 0.45
127 0.39
128 0.34
129 0.34
130 0.27
131 0.23
132 0.24
133 0.2
134 0.22
135 0.26
136 0.27
137 0.27
138 0.34
139 0.34
140 0.32
141 0.34
142 0.32
143 0.24
144 0.28
145 0.3
146 0.23
147 0.26
148 0.21
149 0.21
150 0.28
151 0.31
152 0.31
153 0.33
154 0.33
155 0.3
156 0.4
157 0.4
158 0.33
159 0.35
160 0.33
161 0.35
162 0.37
163 0.36
164 0.27
165 0.31
166 0.33
167 0.34
168 0.32
169 0.26
170 0.23
171 0.23
172 0.22
173 0.17
174 0.17
175 0.1
176 0.11
177 0.14
178 0.14
179 0.14
180 0.14
181 0.14
182 0.12
183 0.12
184 0.11
185 0.09
186 0.08
187 0.08
188 0.09
189 0.1
190 0.11
191 0.12
192 0.12
193 0.13
194 0.14
195 0.16
196 0.14
197 0.14
198 0.13
199 0.14
200 0.14
201 0.13
202 0.12
203 0.13
204 0.13
205 0.14
206 0.14
207 0.12
208 0.11
209 0.1
210 0.11
211 0.08
212 0.07
213 0.06
214 0.05
215 0.06
216 0.07
217 0.09
218 0.09
219 0.09
220 0.1
221 0.1
222 0.11
223 0.12
224 0.11
225 0.1
226 0.13
227 0.19
228 0.23
229 0.26
230 0.28
231 0.27
232 0.26
233 0.27
234 0.26
235 0.23
236 0.19
237 0.19
238 0.22
239 0.27
240 0.27
241 0.27
242 0.27
243 0.24
244 0.25
245 0.24
246 0.25
247 0.27
248 0.32
249 0.39
250 0.42
251 0.44
252 0.46
253 0.51
254 0.51
255 0.5
256 0.47
257 0.44
258 0.44
259 0.44
260 0.41
261 0.35
262 0.3
263 0.23
264 0.22
265 0.17
266 0.15
267 0.13
268 0.13
269 0.14
270 0.16
271 0.2
272 0.25
273 0.28
274 0.27
275 0.3
276 0.38
277 0.43
278 0.43
279 0.42
280 0.42
281 0.39
282 0.36
283 0.34
284 0.27
285 0.21
286 0.2
287 0.21
288 0.17
289 0.17
290 0.17
291 0.16
292 0.13
293 0.14
294 0.13
295 0.11
296 0.1
297 0.11
298 0.12
299 0.17
300 0.17
301 0.15
302 0.16
303 0.16
304 0.16
305 0.18
306 0.18
307 0.14
308 0.13
309 0.14
310 0.14
311 0.19
312 0.18
313 0.19
314 0.27
315 0.28
316 0.29
317 0.31
318 0.33
319 0.3
320 0.33
321 0.38
322 0.31
323 0.32
324 0.32
325 0.35
326 0.32
327 0.3
328 0.27
329 0.2
330 0.17
331 0.16
332 0.15
333 0.1
334 0.13
335 0.11
336 0.12
337 0.12
338 0.14
339 0.16
340 0.16
341 0.16
342 0.15
343 0.16
344 0.22
345 0.25
346 0.29
347 0.3
348 0.31
349 0.39
350 0.38
351 0.39
352 0.33
353 0.34
354 0.28
355 0.27
356 0.28
357 0.2
358 0.2
359 0.18
360 0.17
361 0.11
362 0.1
363 0.11
364 0.08
365 0.12
366 0.11
367 0.11
368 0.11
369 0.14
370 0.15
371 0.12
372 0.13
373 0.09
374 0.09
375 0.1
376 0.09
377 0.09
378 0.08
379 0.08
380 0.09
381 0.11
382 0.11
383 0.11
384 0.11
385 0.1
386 0.1
387 0.09
388 0.1
389 0.09
390 0.1
391 0.1
392 0.11
393 0.11
394 0.11
395 0.11
396 0.1
397 0.09
398 0.08
399 0.09
400 0.08
401 0.09
402 0.11
403 0.11
404 0.11
405 0.11
406 0.12
407 0.13
408 0.14
409 0.13
410 0.11
411 0.11
412 0.11
413 0.11
414 0.1
415 0.08
416 0.08
417 0.1
418 0.13
419 0.15
420 0.15
421 0.21
422 0.25
423 0.29
424 0.34
425 0.34
426 0.32
427 0.34
428 0.35
429 0.3
430 0.26
431 0.22
432 0.17
433 0.15
434 0.13
435 0.09
436 0.09
437 0.07
438 0.07
439 0.07
440 0.08
441 0.09
442 0.08
443 0.09
444 0.08
445 0.08
446 0.08
447 0.08
448 0.1
449 0.09
450 0.09
451 0.08
452 0.08
453 0.08
454 0.09
455 0.1
456 0.08
457 0.11
458 0.11
459 0.11
460 0.11
461 0.11
462 0.11
463 0.11
464 0.13
465 0.14
466 0.14
467 0.15
468 0.17
469 0.18
470 0.18
471 0.17
472 0.15
473 0.14
474 0.18
475 0.18
476 0.16
477 0.14
478 0.15
479 0.15
480 0.14
481 0.12
482 0.09
483 0.08
484 0.08
485 0.09
486 0.08
487 0.08
488 0.08
489 0.09
490 0.11
491 0.11
492 0.11
493 0.13
494 0.16
495 0.18
496 0.2
497 0.22
498 0.23
499 0.26
500 0.29
501 0.3
502 0.31
503 0.37
504 0.42
505 0.42
506 0.41
507 0.39
508 0.38
509 0.39
510 0.41
511 0.38
512 0.36
513 0.35
514 0.31
515 0.3
516 0.29
517 0.25
518 0.2
519 0.16
520 0.1
521 0.14
522 0.14
523 0.14
524 0.15
525 0.14
526 0.14
527 0.16
528 0.16
529 0.13
530 0.14
531 0.14
532 0.15
533 0.15
534 0.15
535 0.13
536 0.12
537 0.11
538 0.12
539 0.11
540 0.11
541 0.12
542 0.11
543 0.11
544 0.11
545 0.11
546 0.11
547 0.11
548 0.1
549 0.09
550 0.09
551 0.09
552 0.11
553 0.11
554 0.11
555 0.11
556 0.13
557 0.15
558 0.18
559 0.2
560 0.18
561 0.17
562 0.19
563 0.21
564 0.23
565 0.27
566 0.32
567 0.3
568 0.34
569 0.35
570 0.33
571 0.29
572 0.26
573 0.21
574 0.2
575 0.23
576 0.22
577 0.26
578 0.25
579 0.31
580 0.34
581 0.37
582 0.39
583 0.41
584 0.46
585 0.5
586 0.55
587 0.5
588 0.48
589 0.45
590 0.37
591 0.31
592 0.25
593 0.16
594 0.13
595 0.19
596 0.17
597 0.2
598 0.22
599 0.24
600 0.29
601 0.33
602 0.39
603 0.38
604 0.42
605 0.42
606 0.45
607 0.44
608 0.38
609 0.35
610 0.28