Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E918

Protein Details
Accession A0A1W0E918   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-60TGTYLKKKSLHKKWNEEETKKHydrophilic
75-123MEMLFKTRKRKCLKEKYIKELKNNKNKVESALRKHKKMDKSKLKEILEMHydrophilic
NLS Segment(s)
PositionSequence
82-117RKRKCLKEKYIKELKNNKNKVESALRKHKKMDKSKL
Subcellular Location(s) nucl 18, mito_nucl 11.833, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR039467  TFIIIB_B''_Myb  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
Amino Acid Sequences MSSYSRKNKNEPNSLQFFCDNKNFKESKLLTRETQDLVTTGTYLKKKSLHKKWNEEETKKFYKALSLCGCDFSLMEMLFKTRKRKCLKEKYIKELKNNKNKVESALRKHKKMDKSKLKEILEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.64
3 0.59
4 0.51
5 0.44
6 0.45
7 0.41
8 0.36
9 0.43
10 0.4
11 0.36
12 0.45
13 0.44
14 0.44
15 0.47
16 0.48
17 0.42
18 0.45
19 0.47
20 0.38
21 0.36
22 0.27
23 0.21
24 0.18
25 0.16
26 0.12
27 0.11
28 0.13
29 0.14
30 0.15
31 0.17
32 0.22
33 0.31
34 0.41
35 0.51
36 0.56
37 0.63
38 0.72
39 0.76
40 0.81
41 0.81
42 0.75
43 0.71
44 0.68
45 0.65
46 0.56
47 0.49
48 0.39
49 0.35
50 0.31
51 0.33
52 0.29
53 0.26
54 0.26
55 0.26
56 0.26
57 0.21
58 0.2
59 0.13
60 0.12
61 0.09
62 0.09
63 0.07
64 0.09
65 0.13
66 0.16
67 0.24
68 0.27
69 0.36
70 0.44
71 0.54
72 0.63
73 0.71
74 0.79
75 0.82
76 0.85
77 0.86
78 0.89
79 0.84
80 0.83
81 0.82
82 0.81
83 0.81
84 0.79
85 0.74
86 0.7
87 0.66
88 0.62
89 0.62
90 0.61
91 0.6
92 0.65
93 0.68
94 0.65
95 0.72
96 0.74
97 0.73
98 0.75
99 0.77
100 0.77
101 0.78
102 0.84
103 0.86