Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NN06

Protein Details
Accession G9NN06   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
10-39TPTLQHPTNHPKREHPKKQGTKNQNPPKALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MDTCTWILTTPTLQHPTNHPKREHPKKQGTKNQNPPKALPNLGRHQKEMKLNSFSSPDPCIASSASGLNPGPFVLINARGRMLAGLAPTSRHLTSITVVPRLCVMNCCRSPYSHVFAKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.47
4 0.54
5 0.58
6 0.54
7 0.59
8 0.69
9 0.78
10 0.8
11 0.8
12 0.81
13 0.83
14 0.91
15 0.91
16 0.91
17 0.9
18 0.91
19 0.91
20 0.87
21 0.8
22 0.72
23 0.67
24 0.61
25 0.54
26 0.5
27 0.46
28 0.48
29 0.54
30 0.53
31 0.49
32 0.48
33 0.49
34 0.49
35 0.47
36 0.43
37 0.39
38 0.38
39 0.37
40 0.36
41 0.31
42 0.27
43 0.23
44 0.19
45 0.15
46 0.14
47 0.14
48 0.11
49 0.11
50 0.09
51 0.09
52 0.08
53 0.09
54 0.09
55 0.08
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.12
63 0.13
64 0.14
65 0.14
66 0.14
67 0.14
68 0.13
69 0.12
70 0.08
71 0.07
72 0.08
73 0.08
74 0.09
75 0.11
76 0.14
77 0.14
78 0.13
79 0.14
80 0.13
81 0.15
82 0.2
83 0.21
84 0.23
85 0.23
86 0.23
87 0.24
88 0.24
89 0.23
90 0.23
91 0.25
92 0.3
93 0.33
94 0.39
95 0.38
96 0.38
97 0.45
98 0.46
99 0.48