Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E8I3

Protein Details
Accession A0A1W0E8I3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-100SGTLKRAKSKIIKIIKNKNIHydrophilic
NLS Segment(s)
PositionSequence
88-90KSK
Subcellular Location(s) nucl 11, cyto_nucl 10.5, mito 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038085  Rnp2-like_sf  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0004526  F:ribonuclease P activity  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MAIFKDVYMVFVNKNDVFPKNEFIVEKIKENYGLLGLSDVFYLEIKEKYVKSKHFIVWCPRNCQKMIEKCLEKHSKLLCKSGTLKRAKSKIIKIIKNKNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.24
4 0.27
5 0.28
6 0.3
7 0.27
8 0.29
9 0.27
10 0.26
11 0.31
12 0.28
13 0.3
14 0.27
15 0.26
16 0.24
17 0.24
18 0.22
19 0.15
20 0.13
21 0.09
22 0.08
23 0.07
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.06
31 0.06
32 0.07
33 0.1
34 0.1
35 0.16
36 0.21
37 0.23
38 0.25
39 0.3
40 0.33
41 0.36
42 0.41
43 0.45
44 0.49
45 0.51
46 0.55
47 0.55
48 0.55
49 0.5
50 0.49
51 0.49
52 0.48
53 0.5
54 0.51
55 0.51
56 0.49
57 0.58
58 0.61
59 0.53
60 0.5
61 0.52
62 0.52
63 0.5
64 0.54
65 0.46
66 0.44
67 0.51
68 0.52
69 0.54
70 0.54
71 0.58
72 0.61
73 0.66
74 0.69
75 0.7
76 0.7
77 0.71
78 0.73
79 0.75
80 0.76