Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E3H3

Protein Details
Accession A0A1W0E3H3   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-115VEKYKGKKHIPKELRPKKTRALRRALTKQQLNKKSRRQRQELAKYKPLVHydrophilic
NLS Segment(s)
PositionSequence
64-105KSLVEKYKGKKHIPKELRPKKTRALRRALTKQQLNKKSRRQR
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
Amino Acid Sequences MSLKAEELRTFTEEQLKVQLRETQDALQHLYQLRHSKQVQPNEIKEARKDIARIKTIQHENKLKSLVEKYKGKKHIPKELRPKKTRALRRALTKQQLNKKSRRQRQELAKYKPLVYTYTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.37
4 0.34
5 0.34
6 0.37
7 0.31
8 0.34
9 0.35
10 0.29
11 0.27
12 0.28
13 0.29
14 0.25
15 0.25
16 0.24
17 0.23
18 0.25
19 0.29
20 0.29
21 0.33
22 0.34
23 0.41
24 0.45
25 0.52
26 0.56
27 0.55
28 0.56
29 0.57
30 0.59
31 0.52
32 0.46
33 0.42
34 0.35
35 0.3
36 0.3
37 0.28
38 0.3
39 0.32
40 0.32
41 0.29
42 0.36
43 0.42
44 0.44
45 0.44
46 0.44
47 0.42
48 0.44
49 0.44
50 0.36
51 0.31
52 0.32
53 0.31
54 0.31
55 0.37
56 0.39
57 0.46
58 0.53
59 0.58
60 0.59
61 0.6
62 0.65
63 0.66
64 0.71
65 0.74
66 0.77
67 0.81
68 0.78
69 0.77
70 0.75
71 0.76
72 0.77
73 0.74
74 0.73
75 0.69
76 0.74
77 0.79
78 0.79
79 0.79
80 0.76
81 0.76
82 0.77
83 0.8
84 0.77
85 0.77
86 0.79
87 0.81
88 0.83
89 0.85
90 0.83
91 0.83
92 0.86
93 0.88
94 0.87
95 0.85
96 0.84
97 0.78
98 0.71
99 0.65
100 0.56