Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E2I6

Protein Details
Accession A0A1W0E2I6    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
75-97EDIPEYKKYVRYKRYIKNKKHIIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 14.5, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR036283  NOB1_Zf-like_sf  
IPR014881  NOB1_Zn-bd  
Pfam View protein in Pfam  
PF08772  NOB1_Zn_bind  
Amino Acid Sequences MGEFTISEKYFKYRCFACFSVFNEKVDFCKLCGHKTVTRVAFIKEDGKEIMCLKKGYNYKEKIIKDKKGVNIVCEDIPEYKKYVRYKRYIKNKKHII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.39
4 0.37
5 0.39
6 0.42
7 0.47
8 0.44
9 0.42
10 0.36
11 0.35
12 0.32
13 0.31
14 0.27
15 0.18
16 0.24
17 0.25
18 0.25
19 0.3
20 0.33
21 0.32
22 0.34
23 0.41
24 0.34
25 0.36
26 0.35
27 0.31
28 0.27
29 0.25
30 0.27
31 0.19
32 0.19
33 0.16
34 0.15
35 0.15
36 0.15
37 0.16
38 0.14
39 0.14
40 0.13
41 0.19
42 0.23
43 0.27
44 0.35
45 0.36
46 0.39
47 0.47
48 0.5
49 0.54
50 0.57
51 0.58
52 0.56
53 0.59
54 0.59
55 0.6
56 0.58
57 0.5
58 0.45
59 0.41
60 0.35
61 0.29
62 0.25
63 0.2
64 0.21
65 0.21
66 0.2
67 0.21
68 0.27
69 0.36
70 0.44
71 0.49
72 0.57
73 0.66
74 0.73
75 0.82
76 0.86
77 0.87