Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E687

Protein Details
Accession A0A1W0E687   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSKIPINNKNNNTNKNKNNNSNNSNDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
Amino Acid Sequences MSKIPINNKNNNTNKNKNNNSNNSNDSNDSNDNPFKVKSIKNISDNTNTNIFNTNNTNNTNINKNKSIFLKKNITTNNKLNNTDNKLNNTNNKLNNTNKCNYINICNVTIDYYDSDDDMYILLAVGNIIIKDRYLIFCRIGIANPLIQLDNINICNNSTDILNNTDNDNICNNTDILNNTNICNSNIDNDNNIIFIYNNIKYKIILNNINDKDIKILKEYFKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.85
4 0.85
5 0.86
6 0.86
7 0.82
8 0.79
9 0.75
10 0.68
11 0.62
12 0.55
13 0.46
14 0.42
15 0.4
16 0.35
17 0.35
18 0.32
19 0.3
20 0.3
21 0.29
22 0.26
23 0.29
24 0.3
25 0.33
26 0.41
27 0.46
28 0.5
29 0.54
30 0.56
31 0.57
32 0.58
33 0.52
34 0.47
35 0.41
36 0.36
37 0.36
38 0.31
39 0.26
40 0.29
41 0.28
42 0.27
43 0.28
44 0.3
45 0.28
46 0.3
47 0.35
48 0.35
49 0.37
50 0.38
51 0.38
52 0.39
53 0.43
54 0.5
55 0.47
56 0.49
57 0.53
58 0.49
59 0.55
60 0.59
61 0.59
62 0.56
63 0.58
64 0.6
65 0.56
66 0.57
67 0.54
68 0.54
69 0.54
70 0.55
71 0.51
72 0.47
73 0.46
74 0.47
75 0.49
76 0.48
77 0.47
78 0.44
79 0.44
80 0.45
81 0.47
82 0.51
83 0.5
84 0.46
85 0.44
86 0.42
87 0.4
88 0.36
89 0.34
90 0.31
91 0.27
92 0.26
93 0.21
94 0.2
95 0.18
96 0.17
97 0.13
98 0.09
99 0.08
100 0.07
101 0.07
102 0.07
103 0.06
104 0.06
105 0.05
106 0.04
107 0.03
108 0.03
109 0.03
110 0.03
111 0.02
112 0.02
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.05
120 0.07
121 0.1
122 0.12
123 0.13
124 0.13
125 0.15
126 0.15
127 0.15
128 0.15
129 0.13
130 0.12
131 0.11
132 0.12
133 0.1
134 0.1
135 0.1
136 0.08
137 0.1
138 0.11
139 0.11
140 0.1
141 0.1
142 0.11
143 0.11
144 0.11
145 0.08
146 0.08
147 0.09
148 0.13
149 0.15
150 0.15
151 0.16
152 0.18
153 0.18
154 0.19
155 0.19
156 0.16
157 0.15
158 0.16
159 0.15
160 0.13
161 0.15
162 0.15
163 0.16
164 0.18
165 0.19
166 0.18
167 0.21
168 0.22
169 0.21
170 0.21
171 0.19
172 0.19
173 0.23
174 0.24
175 0.23
176 0.22
177 0.22
178 0.19
179 0.19
180 0.15
181 0.1
182 0.11
183 0.15
184 0.17
185 0.21
186 0.22
187 0.23
188 0.23
189 0.27
190 0.32
191 0.34
192 0.37
193 0.38
194 0.47
195 0.48
196 0.52
197 0.49
198 0.42
199 0.41
200 0.38
201 0.36
202 0.3
203 0.34