Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E5Y3

Protein Details
Accession A0A1W0E5Y3   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-29DLHKPHLESNKHKKKRIFRTCNSYFMHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000592  Ribosomal_S27  
IPR023407  Ribosomal_S27_Zn-bd_dom_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01667  Ribosomal_S27e  
PROSITE View protein in PROSITE  
PS01168  RIBOSOMAL_S27E  
Amino Acid Sequences MADLHKPHLESNKHKKKRIFRTCNSYFMHLKCKDCETTTIGFSHSQTPIKCKLCSALILKPTGGKAKLAEGVAFKVAENEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.81
4 0.85
5 0.86
6 0.85
7 0.82
8 0.84
9 0.81
10 0.81
11 0.73
12 0.66
13 0.6
14 0.51
15 0.52
16 0.46
17 0.43
18 0.37
19 0.38
20 0.35
21 0.31
22 0.32
23 0.26
24 0.24
25 0.22
26 0.21
27 0.19
28 0.17
29 0.17
30 0.17
31 0.16
32 0.17
33 0.17
34 0.2
35 0.27
36 0.3
37 0.29
38 0.27
39 0.27
40 0.26
41 0.3
42 0.3
43 0.28
44 0.28
45 0.29
46 0.28
47 0.27
48 0.28
49 0.28
50 0.25
51 0.21
52 0.18
53 0.21
54 0.25
55 0.24
56 0.24
57 0.2
58 0.21
59 0.22
60 0.21
61 0.17