Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E3B3

Protein Details
Accession A0A1W0E3B3   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-38GSEKSSKQPTKSKKNKIQKNQIKEQKTKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 6.5, cyto_mito 5, mito 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSLWEWLFGSEKSSKQPTKSKKNKIQKNQIKEQKTKTNTNIKENKNQNEDKDVFGNSVYSLDNKNISSQTKVNSLSGQNEKENKHKGKYTYTFIGIGIVCLVTTIGGITYYKLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.41
4 0.51
5 0.57
6 0.64
7 0.73
8 0.78
9 0.8
10 0.87
11 0.91
12 0.92
13 0.93
14 0.91
15 0.89
16 0.89
17 0.87
18 0.85
19 0.81
20 0.78
21 0.77
22 0.73
23 0.71
24 0.68
25 0.69
26 0.65
27 0.68
28 0.7
29 0.64
30 0.68
31 0.68
32 0.67
33 0.63
34 0.62
35 0.53
36 0.52
37 0.48
38 0.41
39 0.35
40 0.28
41 0.21
42 0.18
43 0.17
44 0.09
45 0.09
46 0.08
47 0.07
48 0.08
49 0.08
50 0.1
51 0.1
52 0.11
53 0.13
54 0.14
55 0.16
56 0.17
57 0.18
58 0.22
59 0.23
60 0.22
61 0.23
62 0.23
63 0.26
64 0.29
65 0.3
66 0.29
67 0.34
68 0.35
69 0.4
70 0.48
71 0.47
72 0.46
73 0.49
74 0.49
75 0.53
76 0.56
77 0.55
78 0.51
79 0.49
80 0.45
81 0.39
82 0.38
83 0.28
84 0.23
85 0.17
86 0.11
87 0.09
88 0.08
89 0.08
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.07