Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E7V3

Protein Details
Accession A0A1W0E7V3    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-76TWYFRKKITYRWKLMCKKKSNILAYKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, plas 7, E.R. 3, golg 2, mito 1, extr 1, pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSSNQDYLQESSISNFIGNNLKNTTTAKYSFVNYLCWFILCSFFIFICITWYFRKKITYRWKLMCKKKSNILAYKQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.11
4 0.11
5 0.17
6 0.17
7 0.19
8 0.19
9 0.2
10 0.21
11 0.23
12 0.23
13 0.2
14 0.2
15 0.2
16 0.2
17 0.21
18 0.23
19 0.22
20 0.23
21 0.2
22 0.21
23 0.18
24 0.17
25 0.16
26 0.12
27 0.13
28 0.1
29 0.1
30 0.08
31 0.08
32 0.09
33 0.09
34 0.08
35 0.1
36 0.1
37 0.12
38 0.15
39 0.19
40 0.19
41 0.22
42 0.29
43 0.28
44 0.38
45 0.47
46 0.53
47 0.59
48 0.66
49 0.74
50 0.77
51 0.86
52 0.86
53 0.84
54 0.81
55 0.82
56 0.82
57 0.81
58 0.8