Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E7H8

Protein Details
Accession A0A1W0E7H8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-71VDNKIREHHSRKTKNKKTYKKHKTKIKNVENTIBasic
NLS Segment(s)
PositionSequence
45-64EHHSRKTKNKKTYKKHKTKI
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 5
Family & Domain DBs
Amino Acid Sequences MHFTDEFNEITRKYQKQIDFICSKYSEIEEDESSYVSFVDNKIREHHSRKTKNKKTYKKHKTKIKNVENTIELSDKNIETLKIKTNKINFTNNKKANKVKICKTFKYTHFNEILRYYLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.46
4 0.5
5 0.53
6 0.5
7 0.49
8 0.5
9 0.43
10 0.4
11 0.33
12 0.29
13 0.22
14 0.19
15 0.21
16 0.17
17 0.17
18 0.17
19 0.16
20 0.15
21 0.13
22 0.11
23 0.08
24 0.08
25 0.07
26 0.14
27 0.15
28 0.17
29 0.21
30 0.26
31 0.32
32 0.37
33 0.45
34 0.48
35 0.57
36 0.66
37 0.74
38 0.78
39 0.82
40 0.87
41 0.89
42 0.89
43 0.9
44 0.91
45 0.9
46 0.9
47 0.89
48 0.89
49 0.9
50 0.9
51 0.88
52 0.86
53 0.78
54 0.72
55 0.63
56 0.54
57 0.45
58 0.35
59 0.25
60 0.18
61 0.17
62 0.13
63 0.12
64 0.12
65 0.11
66 0.11
67 0.14
68 0.21
69 0.26
70 0.28
71 0.33
72 0.38
73 0.45
74 0.48
75 0.56
76 0.57
77 0.6
78 0.69
79 0.71
80 0.71
81 0.7
82 0.72
83 0.72
84 0.74
85 0.73
86 0.71
87 0.75
88 0.76
89 0.76
90 0.76
91 0.74
92 0.72
93 0.73
94 0.67
95 0.65
96 0.64
97 0.59
98 0.57
99 0.51