Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E686

Protein Details
Accession A0A1W0E686    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
26-53NTDCEHKTTKKVKKTTKHTTTKNIIRDKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito_nucl 9.5, mito 7.5, pero 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MIRRKQNHKGSDKTGNSNTDSNTDSNTDCEHKTTKKVKKTTKHTTTKNIIRDKDGKIVFDDYPDFKPNLTPKEVLQLGSFGGTYFRPIESSITNKSYRDVWKEFPSDWFEGLNITKEVTSLTYYNDVNKYKVKCGGSLQMWEESGWIKKEDPYGWFQWYCRFYLGRRCKDDTRQIERWMKCAGPKGRWKNNLINKCYKSEKNFDDFSVSPVIRQVLQHWAYVLTENDYKKYLESNNKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.66
3 0.61
4 0.56
5 0.5
6 0.42
7 0.39
8 0.32
9 0.28
10 0.26
11 0.22
12 0.21
13 0.23
14 0.23
15 0.21
16 0.24
17 0.27
18 0.29
19 0.38
20 0.47
21 0.52
22 0.59
23 0.68
24 0.74
25 0.78
26 0.85
27 0.86
28 0.87
29 0.88
30 0.85
31 0.85
32 0.85
33 0.83
34 0.82
35 0.79
36 0.7
37 0.67
38 0.66
39 0.6
40 0.58
41 0.51
42 0.43
43 0.38
44 0.39
45 0.32
46 0.28
47 0.27
48 0.21
49 0.23
50 0.25
51 0.22
52 0.19
53 0.24
54 0.27
55 0.29
56 0.3
57 0.27
58 0.25
59 0.33
60 0.34
61 0.3
62 0.24
63 0.2
64 0.16
65 0.16
66 0.15
67 0.07
68 0.07
69 0.06
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.11
76 0.12
77 0.16
78 0.18
79 0.22
80 0.23
81 0.23
82 0.23
83 0.26
84 0.28
85 0.31
86 0.3
87 0.3
88 0.34
89 0.36
90 0.36
91 0.34
92 0.34
93 0.29
94 0.26
95 0.22
96 0.16
97 0.15
98 0.15
99 0.13
100 0.09
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.07
108 0.08
109 0.1
110 0.1
111 0.13
112 0.17
113 0.17
114 0.18
115 0.23
116 0.24
117 0.23
118 0.29
119 0.27
120 0.25
121 0.26
122 0.3
123 0.27
124 0.28
125 0.27
126 0.23
127 0.22
128 0.2
129 0.18
130 0.13
131 0.13
132 0.12
133 0.11
134 0.11
135 0.12
136 0.16
137 0.17
138 0.19
139 0.21
140 0.23
141 0.26
142 0.27
143 0.25
144 0.29
145 0.29
146 0.28
147 0.25
148 0.24
149 0.22
150 0.32
151 0.42
152 0.44
153 0.48
154 0.53
155 0.56
156 0.62
157 0.7
158 0.69
159 0.67
160 0.64
161 0.67
162 0.7
163 0.65
164 0.6
165 0.53
166 0.45
167 0.4
168 0.43
169 0.41
170 0.4
171 0.5
172 0.57
173 0.64
174 0.69
175 0.72
176 0.73
177 0.77
178 0.78
179 0.74
180 0.74
181 0.68
182 0.66
183 0.68
184 0.64
185 0.6
186 0.6
187 0.59
188 0.55
189 0.55
190 0.5
191 0.49
192 0.43
193 0.39
194 0.38
195 0.31
196 0.25
197 0.25
198 0.26
199 0.21
200 0.21
201 0.21
202 0.23
203 0.25
204 0.25
205 0.24
206 0.23
207 0.22
208 0.24
209 0.23
210 0.18
211 0.22
212 0.23
213 0.24
214 0.25
215 0.25
216 0.23
217 0.27
218 0.31