Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E6S1

Protein Details
Accession A0A1W0E6S1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-73GCPFVTKKVRRENKNKNNSKKKPKSGYCEVCCHydrophilic
NLS Segment(s)
PositionSequence
48-65KKVRRENKNKNNSKKKPK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MKNFRHFSSQYILIEDSKGKHQPIYKEYEKSPPKMTVVEKIGCPFVTKKVRRENKNKNNSKKKPKSGYCEVCCMRYSSYLEHMKQEHVTCECASLDEFVREFKEVVIETTSIDYENSPSTNMRSVYYLSSYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.25
4 0.24
5 0.27
6 0.25
7 0.27
8 0.32
9 0.37
10 0.4
11 0.46
12 0.46
13 0.47
14 0.49
15 0.55
16 0.55
17 0.51
18 0.51
19 0.45
20 0.41
21 0.41
22 0.41
23 0.38
24 0.39
25 0.37
26 0.33
27 0.31
28 0.31
29 0.26
30 0.26
31 0.19
32 0.22
33 0.3
34 0.34
35 0.4
36 0.49
37 0.58
38 0.65
39 0.75
40 0.78
41 0.78
42 0.85
43 0.87
44 0.87
45 0.9
46 0.91
47 0.91
48 0.9
49 0.88
50 0.87
51 0.84
52 0.81
53 0.8
54 0.8
55 0.71
56 0.7
57 0.61
58 0.53
59 0.47
60 0.4
61 0.31
62 0.25
63 0.24
64 0.17
65 0.24
66 0.28
67 0.28
68 0.3
69 0.31
70 0.29
71 0.3
72 0.29
73 0.25
74 0.2
75 0.22
76 0.18
77 0.19
78 0.17
79 0.14
80 0.14
81 0.12
82 0.12
83 0.12
84 0.12
85 0.11
86 0.13
87 0.13
88 0.13
89 0.11
90 0.13
91 0.12
92 0.13
93 0.14
94 0.13
95 0.13
96 0.14
97 0.14
98 0.11
99 0.11
100 0.1
101 0.1
102 0.12
103 0.12
104 0.12
105 0.14
106 0.16
107 0.21
108 0.22
109 0.21
110 0.21
111 0.22
112 0.24