Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E3C9

Protein Details
Accession A0A1W0E3C9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-26LKNNNKKFNNINENKKRWKLHydrophilic
NLS Segment(s)
PositionSequence
48-58KKHKKKEETGK
Subcellular Location(s) nucl 13.5, cyto_nucl 8.333, plas 5, cyto_mito 2.333, cyto 2, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSPKIDLKNNNKKFNNINENKKRWKLLIFFLAVLVIGGITFLCIFFIKKHKKKEETGKVDEKVKEKYKGDKID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.7
4 0.72
5 0.72
6 0.77
7 0.81
8 0.78
9 0.71
10 0.62
11 0.59
12 0.52
13 0.47
14 0.45
15 0.37
16 0.33
17 0.3
18 0.27
19 0.2
20 0.17
21 0.11
22 0.04
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.03
31 0.04
32 0.07
33 0.17
34 0.28
35 0.35
36 0.45
37 0.54
38 0.61
39 0.69
40 0.78
41 0.79
42 0.78
43 0.79
44 0.78
45 0.73
46 0.73
47 0.69
48 0.62
49 0.6
50 0.58
51 0.58
52 0.54
53 0.59