Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E3R5

Protein Details
Accession A0A1W0E3R5    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MKGAKRMSKRITTRKREKINKKVREHHRKVRKEARNKKKIPSBasic
NLS Segment(s)
PositionSequence
3-40GAKRMSKRITTRKREKINKKVREHHRKVRKEARNKKKI
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MKGAKRMSKRITTRKREKINKKVREHHRKVRKEARNKKKIPSSVFVTQTHREHLQRIKEDTDKRTKEFYENKQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.91
4 0.92
5 0.92
6 0.92
7 0.91
8 0.9
9 0.89
10 0.9
11 0.9
12 0.88
13 0.88
14 0.87
15 0.85
16 0.85
17 0.86
18 0.84
19 0.83
20 0.86
21 0.86
22 0.86
23 0.82
24 0.79
25 0.76
26 0.73
27 0.67
28 0.61
29 0.56
30 0.52
31 0.53
32 0.49
33 0.46
34 0.45
35 0.42
36 0.4
37 0.38
38 0.33
39 0.34
40 0.37
41 0.41
42 0.41
43 0.44
44 0.45
45 0.49
46 0.54
47 0.57
48 0.61
49 0.57
50 0.55
51 0.57
52 0.55
53 0.57
54 0.6