Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W0E404

Protein Details
Accession A0A1W0E404    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
102-121MATAKNKKHNIEKLVKKKYFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR031495  DUF5100  
Pfam View protein in Pfam  
PF17029  DUF5100  
Amino Acid Sequences MNRKKLHSKLNELLKNTTNENLLETINNIEYQINQCTNTSSTAIIPQEANFQLPTQFLGIKKNVEIEGLFIESNKTSVNDEKIDRIVTFLEETMGNESFSTMATAKNKKHNIEKLVKKKYFGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.56
3 0.48
4 0.42
5 0.33
6 0.28
7 0.26
8 0.22
9 0.18
10 0.16
11 0.14
12 0.14
13 0.13
14 0.12
15 0.11
16 0.1
17 0.11
18 0.13
19 0.16
20 0.15
21 0.15
22 0.16
23 0.17
24 0.18
25 0.18
26 0.17
27 0.13
28 0.12
29 0.15
30 0.15
31 0.14
32 0.13
33 0.12
34 0.15
35 0.15
36 0.15
37 0.11
38 0.11
39 0.11
40 0.11
41 0.11
42 0.08
43 0.09
44 0.09
45 0.12
46 0.13
47 0.13
48 0.13
49 0.14
50 0.14
51 0.12
52 0.12
53 0.09
54 0.09
55 0.09
56 0.08
57 0.07
58 0.08
59 0.07
60 0.07
61 0.07
62 0.07
63 0.08
64 0.11
65 0.14
66 0.16
67 0.17
68 0.19
69 0.21
70 0.21
71 0.19
72 0.17
73 0.15
74 0.13
75 0.12
76 0.1
77 0.1
78 0.09
79 0.1
80 0.12
81 0.12
82 0.11
83 0.1
84 0.1
85 0.09
86 0.09
87 0.1
88 0.08
89 0.11
90 0.18
91 0.25
92 0.3
93 0.4
94 0.46
95 0.51
96 0.6
97 0.64
98 0.67
99 0.71
100 0.76
101 0.78
102 0.82
103 0.79