Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E3H2

Protein Details
Accession A0A1W0E3H2    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
120-143AKCIDFMQRKVKNKKEFFKYKIKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9cyto_nucl 9, nucl 8.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001232  SKP1-like  
IPR011333  SKP1/BTB/POZ_sf  
IPR016073  Skp1_comp_POZ  
Gene Ontology GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF03931  Skp1_POZ  
Amino Acid Sequences MIWLFIVSSYAYFYQTNNFIKNIIFQKFINSLNILLYTFEMAENNEFLYIKLISSDNKSFEITKEIADVSGTLKLFIENFENNMNIKGNVKGIKLKNTESNKTQKNECIIKLPIKAEMLAKCIDFMQRKVKNKKEFFKYKIKDEEVIELLDVASYLRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.24
3 0.27
4 0.27
5 0.27
6 0.25
7 0.25
8 0.32
9 0.33
10 0.29
11 0.28
12 0.26
13 0.3
14 0.33
15 0.34
16 0.3
17 0.25
18 0.22
19 0.21
20 0.21
21 0.16
22 0.13
23 0.12
24 0.09
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.08
31 0.08
32 0.08
33 0.08
34 0.07
35 0.09
36 0.09
37 0.07
38 0.09
39 0.09
40 0.1
41 0.15
42 0.17
43 0.17
44 0.18
45 0.19
46 0.18
47 0.18
48 0.21
49 0.17
50 0.15
51 0.14
52 0.13
53 0.12
54 0.11
55 0.1
56 0.07
57 0.09
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.1
65 0.07
66 0.09
67 0.09
68 0.1
69 0.1
70 0.11
71 0.11
72 0.09
73 0.1
74 0.09
75 0.12
76 0.13
77 0.14
78 0.2
79 0.22
80 0.29
81 0.31
82 0.32
83 0.38
84 0.41
85 0.45
86 0.43
87 0.5
88 0.49
89 0.49
90 0.5
91 0.45
92 0.46
93 0.47
94 0.42
95 0.39
96 0.37
97 0.38
98 0.39
99 0.36
100 0.32
101 0.27
102 0.27
103 0.26
104 0.24
105 0.22
106 0.19
107 0.19
108 0.16
109 0.16
110 0.21
111 0.2
112 0.22
113 0.3
114 0.37
115 0.48
116 0.57
117 0.66
118 0.71
119 0.77
120 0.83
121 0.83
122 0.85
123 0.81
124 0.82
125 0.79
126 0.78
127 0.78
128 0.72
129 0.67
130 0.59
131 0.59
132 0.49
133 0.44
134 0.35
135 0.25
136 0.21
137 0.16
138 0.14