Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E7X8

Protein Details
Accession A0A1W0E7X8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-34VNLLKKIVLRHKKQFKGHKVMNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 9.833, mito 5.5, cyto_mito 5.332, pero 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027951  Nepro_N  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF14780  DUF4477  
Amino Acid Sequences MDKYDKMYNSEVNLLKKIVLRHKKQFKGHKVMNNLVMLNNILLKNKNIFENKKIFLKSIELCKNVYVLCSREVVSGFFLHFNMLVMGIVSRIHFLLKKFEKNHLKNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.31
4 0.34
5 0.37
6 0.43
7 0.47
8 0.55
9 0.65
10 0.72
11 0.78
12 0.82
13 0.82
14 0.82
15 0.82
16 0.79
17 0.75
18 0.71
19 0.66
20 0.58
21 0.48
22 0.38
23 0.31
24 0.24
25 0.17
26 0.15
27 0.11
28 0.1
29 0.1
30 0.11
31 0.13
32 0.14
33 0.19
34 0.22
35 0.24
36 0.28
37 0.33
38 0.34
39 0.37
40 0.36
41 0.31
42 0.27
43 0.28
44 0.26
45 0.29
46 0.32
47 0.29
48 0.28
49 0.28
50 0.28
51 0.24
52 0.23
53 0.16
54 0.12
55 0.12
56 0.13
57 0.14
58 0.14
59 0.14
60 0.14
61 0.13
62 0.13
63 0.12
64 0.11
65 0.11
66 0.1
67 0.09
68 0.09
69 0.07
70 0.07
71 0.06
72 0.05
73 0.05
74 0.05
75 0.06
76 0.05
77 0.06
78 0.06
79 0.08
80 0.1
81 0.12
82 0.22
83 0.29
84 0.38
85 0.41
86 0.51
87 0.6
88 0.66