Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E3L6

Protein Details
Accession A0A1W0E3L6    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
23-55KRVKILHRPALKKKRPKYKIYKLPKNKLKGKIABasic
NLS Segment(s)
PositionSequence
23-53KRVKILHRPALKKKRPKYKIYKLPKNKLKGK
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MRNDENKENIDPMFDTGQPHEVKRVKILHRPALKKKRPKYKIYKLPKNKLKGKIAEEVYFSSETYDLFSRDIKKKEDKSSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.24
5 0.23
6 0.23
7 0.28
8 0.3
9 0.29
10 0.34
11 0.4
12 0.39
13 0.45
14 0.51
15 0.52
16 0.56
17 0.63
18 0.68
19 0.71
20 0.75
21 0.77
22 0.79
23 0.81
24 0.8
25 0.82
26 0.82
27 0.82
28 0.84
29 0.85
30 0.87
31 0.86
32 0.89
33 0.87
34 0.85
35 0.82
36 0.8
37 0.77
38 0.72
39 0.66
40 0.64
41 0.6
42 0.53
43 0.46
44 0.39
45 0.35
46 0.29
47 0.24
48 0.18
49 0.14
50 0.12
51 0.13
52 0.14
53 0.12
54 0.12
55 0.16
56 0.23
57 0.3
58 0.35
59 0.39
60 0.47
61 0.55