Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W0E4G0

Protein Details
Accession A0A1W0E4G0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
103-126KEKTEKIKNKIKIKSEKLEKLKNEBasic
NLS Segment(s)
PositionSequence
108-117KIKNKIKIKS
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MFENKLSLKELQELFTMFKEEEEKLKIKHKKLLEETLTHKMNLKKTENEKKLHLNRLEDLEKLNIEIIKEKNENEKLKEHYDNEIIWIKEDIMAAVRNLDGLKEKTEKIKNKIKIKSEKLEKLKNENERDSLFDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.23
4 0.16
5 0.16
6 0.17
7 0.17
8 0.2
9 0.23
10 0.25
11 0.26
12 0.36
13 0.42
14 0.44
15 0.5
16 0.51
17 0.55
18 0.58
19 0.65
20 0.59
21 0.56
22 0.57
23 0.58
24 0.54
25 0.45
26 0.43
27 0.38
28 0.4
29 0.42
30 0.41
31 0.41
32 0.49
33 0.6
34 0.61
35 0.59
36 0.58
37 0.61
38 0.63
39 0.64
40 0.58
41 0.5
42 0.45
43 0.47
44 0.45
45 0.35
46 0.29
47 0.22
48 0.18
49 0.16
50 0.15
51 0.1
52 0.08
53 0.12
54 0.11
55 0.14
56 0.15
57 0.16
58 0.22
59 0.28
60 0.31
61 0.3
62 0.34
63 0.33
64 0.37
65 0.41
66 0.35
67 0.32
68 0.32
69 0.29
70 0.28
71 0.28
72 0.23
73 0.2
74 0.19
75 0.15
76 0.15
77 0.15
78 0.11
79 0.09
80 0.1
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.08
87 0.11
88 0.11
89 0.16
90 0.18
91 0.2
92 0.28
93 0.37
94 0.44
95 0.48
96 0.56
97 0.61
98 0.68
99 0.74
100 0.76
101 0.78
102 0.78
103 0.81
104 0.81
105 0.82
106 0.81
107 0.82
108 0.79
109 0.78
110 0.78
111 0.77
112 0.75
113 0.7
114 0.66
115 0.59